SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015739 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015739
Domain Number 1 Region: 275-394
Classification Level Classification E-value
Superfamily TIMP-like 9.42e-36
Family Netrin-like domain (NTR/C345C module) 0.00037
Further Details:      
 
Domain Number 2 Region: 9-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 129-242
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-33
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015739   Gene: ENSTNIG00000012766   Transcript: ENSTNIT00000015948
Sequence length 394
Comment pep:known_by_projection chromosome:TETRAODON8:6:4631226:4635686:-1 gene:ENSTNIG00000012766 transcript:ENSTNIT00000015948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASRPVFTCGGNITDSGVIGSQGYPGVYPPNTKCVWKITVPQGKVVVLSFRFIDLESDNL
CRYDYVDVYSGHVNGQRLGRFCGTFKPGALVSTGNKMLLQMMSDANTAGSGFLAVFSAAH
PHERGDRYCGGRLDKPAGTFKTPNWPEKDYPAGVTCSWHIVAPKNQIIEVKFEKFDVERD
NYCRYDHVSIFNGAEINDAKRIGKYCGDSPPAPVLSDGNQLLIQFLSDLSLTADGFIGHY
KFRPKKFPPTTTVAPTTTAAPATTRPIPLKYSVALCQQKCKRRGTLESNYCSSNFVITGT
VITAVMRGGSMYATVSIINVYKEGNLAIQQAGKTMSTKIVILCKKCPFVRRGLNYVFTGQ
VDEDGRGKIAPHHFVMAFKTKNQKGLNVLKNKQC
Download sequence
Identical sequences H3D5F0
ENSTNIP00000015739 99883.ENSTNIP00000015739 ENSTNIP00000015739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]