SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015769 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015769
Domain Number 1 Region: 186-278
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000714
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 2 Region: 56-122
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000135
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015769   Gene: ENSTNIG00000012796   Transcript: ENSTNIT00000015978
Sequence length 681
Comment pep:novel chromosome:TETRAODON8:2:7457553:7472939:-1 gene:ENSTNIG00000012796 transcript:ENSTNIT00000015978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKSASLSSPSAARRLYRNLSGKFRVGTNPPGLEDSVVSGRWGDKERLRKTTIQFQSNET
LFEAVEHQELDLVQLLLSQYSLEELDLNTPNSEGLLPLDIAIMTNNVPMAKLLLQAGAKE
SPHFVSLEGRAVHLATLVRRGRHPGTRSGAEGSSEWEGSDPDRQLKAWEWRLRFRRMQTG
FEHANPPEAPGAVYLSVSSSTSLSVDFQEPLSVNSAVVTKYKAVGWSTAPSFSPLLGEMV
VEDTTLLQCNITGLTSNTDYYVQVSAYNMKGWGPPLVSTPACAAPSSWRDVEGRSPRQKG
QKEVLDQLLGHIKEAHRHCVCHEQCKAPSQGRKHSVSKSLRHLFQPTSKFVKNLKRGLYL
TSILYRDDGVLVTSEDQIPIVEVEDCYSSSLMQDFLWFTKVSYLWEEILWLQQCLSLSQS
SSSCTLQTRLKMLQAASQLQGMLGTQDLGQVYFEPIKDKHGNALLVLLKDMNTCPNLDGV
HWMQLGKLQLQRKSISSPEEPTALDMLLITLHEKLAYHRRSRKTLSPGLYLGYLKLCTSV
EQIRALVPQKLPNVLCHTKIRDNSHVSREEWQWLQTLSCLQKSEEMGQEGQTTTHRLQDE
LRTAIRDLMAHINTPGSQAQEFRIYSQEVLEFGEKVSFLLLLPPSEEVCTAPGQKNPYSP
RSGFLTLPLQIFELGLFFKLA
Download sequence
Identical sequences H3D5I0
ENSTNIP00000015769 99883.ENSTNIP00000015769 ENSTNIP00000015769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]