SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015779 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015779
Domain Number 1 Region: 540-615
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 4.19e-28
Family VHP, Villin headpiece domain 0.0000926
Further Details:      
 
Domain Number 2 Region: 235-270
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000137
Family LIM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 178-238
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000124
Family LIM domain 0.0054
Further Details:      
 
Domain Number 4 Region: 52-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000362
Family LIM domain 0.0043
Further Details:      
 
Domain Number 5 Region: 109-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000011
Family LIM domain 0.0046
Further Details:      
 
Domain Number 6 Region: 20-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000063
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015779
Domain Number - Region: 146-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000683
Family LIM domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015779   Gene: ENSTNIG00000012806   Transcript: ENSTNIT00000015988
Sequence length 615
Comment pep:known_by_projection chromosome:TETRAODON8:2:7322331:7330612:-1 gene:ENSTNIG00000012806 transcript:ENSTNIT00000015988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLMTVLHTQDGCLRSPSSERRVIHCFKCGELCRGQVLRVQANHFHVKCFTCKVCGCDMA
QSGFFIRNGDYLCPLDFQRLHGTPCNNCREFVEGEVVTVLGKTYHPACFVCNICKQAFTA
GEFVTFSGKDFFCQHCFQPLSPTQPSYPNHCSGWGTDIKNGQALLALGGHWHLGCFKCKC
RKVLCGEYISKDGVPYCERDYQNKFGIQCDACQKFITGKVLEAGVKHYHPTCARCSQCGK
LFTEGDEMYLQGSAVWHPHCRNSSRTEDSYRSIRSSSESSCSRPSSCTPGSPSRTISAKV
DNEIIDYRDLAAIPRVKAIFDIEHPDMISYETVNGSSSTLEKRRNRQDSQSVVKILPPTC
VLGYDRFRESFDERKCIPKSTSHGSFGVNAMYSRHSYTPSLSRSPQHFHRPDDGFNMYRK
PPIYKQQGTTKCSLFICIFKIMVNCHLIFLSLKLNLNRCFCPVHLRTNELGTKTNPPKKK
YHDKKLKSSTSQTTSLPGYGRNGLGPPRSADFSQYSADTFRGKILDYKPIHDGPLVGMGR
GVSMPNLFEPNIYPYEMLTVANKGQVKLPKNVDRTRLERHLSPDSFFDVFGMTIQEFDKL
PLWKRNDMKKKANLF
Download sequence
Identical sequences H3D5J0
ENSTNIP00000015779 99883.ENSTNIP00000015779 ENSTNIP00000015779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]