SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015802 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015802
Domain Number 1 Region: 38-224
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.16e-49
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 408-475
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000134
Family SAM (sterile alpha motif) domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015802   Gene: ENSTNIG00000012827   Transcript: ENSTNIT00000016011
Sequence length 641
Comment pep:known_by_projection chromosome:TETRAODON8:2:7064829:7068201:1 gene:ENSTNIG00000012827 transcript:ENSTNIT00000016011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELSDEASESEQLASSLSLWLGDSLVRAEDLDVPLDLYTACSIGQYDVVAECIQKPEVD
LDGKNKGGWTPLMYASYIGHDNIANLLLEAGVNVNASTAKGVTPLMLAASCGNESIAYFL
LQQQHGADLELKDWRGWTALFHCTSTGHQQMVKFLLDNNADADVKEPGSGFTPLMEAAAS
GHEIIVQHLLDHKVKMNERNSKGENARALAMMYGYTKIVSLIDSRSPRIKGSYLSGHFED
LSSSEDSDGAPQRSRPSRNRAKGVSIHDGPQAIAKFRVGGSSKQSVTLAELNAPPGYAAY
PDTGEQSDRICFRDVTSPINELDVQSSSSRDTDLPTMRSSSSSSDGRPHLAALSREGSVE
SNEDSDQCRRSGSRRTSKGHHSKCKGRPEAGPPGGGAECGARFHAGLPSSYTGPKDLAEF
LEQIGFSKYLPLLQEQDVDLRIFLTLTENDLKEIGITLFGPKRKMTSAIARWHSSARPPG
DALEQAYADQLEAKMQEMAIQLHKRCEEVESLQSQLAQERELRAVMEGCLMEEKMAWRRV
TGELVENHRLAQDMRAALAQLGACRSELLCRLSAPERSITAVQGGPTGSKVKQGLSGFST
DELKQKLDSSEEELVGKLQTVLQSLRRLSALEKVSDNWDRP
Download sequence
Identical sequences H3D5L3
99883.ENSTNIP00000015802 ENSTNIP00000015802 ENSTNIP00000015802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]