SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015812 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015812
Domain Number 1 Region: 46-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-47
Family Ankyrin repeat 0.00048
Further Details:      
 
Domain Number 2 Region: 489-585
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.00000537
Further Details:      
 
Domain Number 3 Region: 393-455
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-18
Family SH3-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015812   Gene: ENSTNIG00000012837   Transcript: ENSTNIT00000016022
Sequence length 644
Comment pep:known_by_projection chromosome:TETRAODON8:2:6950726:6961347:1 gene:ENSTNIG00000012837 transcript:ENSTNIT00000016022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICGKRAPSGSFVFQFRYKTRVYKQTNLDEKALSKLSTKASLKKFLEYIQTGSVEKIAKVL
EKGLDPNFHDPDSGETPLTVATQSGLLMEGIKVLVQGGAHLDFRNRDGFTALHKAVWAHN
HAGLLVLLSLGASANYKDRCGLTPLYHTVLVGGDTSCCETLLYYRATLGTRDENGWDESH
QACQQGFAQHLEHLLFYGADISSQNASGNTALHISALYNKESCARVLLYRGANKEAKNKL
GQTPFQLAIMSGHFELGEIIKNHKDSDVVFFLESPKYVPRRKESSHTLPLPSQHSYPLLR
ANSENTMSQSDPPVLPSKAATNPNPRQNQRRASIGARSSSSPRTRTRSPSRGRGGQSDTE
ERHRQPRGRQGGFLSLCSGTSAGGAGGQMKRMYSAVPGRVYVATRAHSASGERELSLSKG
DKVKVLSVGEGGYWEGTVKGRTGWFPSDCVEEVVKDNRSETRSEKAKRKLFRNVTVGAYD
GTDGPSDYIIKEKTVLLQKKDNEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGG
VAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNSLMVKVVMVARNPELEETARKK
APQQTKRLTPPAIALRSKSMTSELEDMDKLDEILAAAQHTITSD
Download sequence
Identical sequences H3D5M3
ENSTNIP00000015812 ENSTNIP00000015812 99883.ENSTNIP00000015812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]