SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015815 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015815
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-33
Family Phosphotyrosine-binding domain (PTB) 0.00025
Further Details:      
 
Domain Number 2 Region: 449-523
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.00061
Further Details:      
 
Domain Number 3 Region: 650-708
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000015
Family SAM (sterile alpha motif) domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015815   Gene: ENSTNIG00000012840   Transcript: ENSTNIT00000016025
Sequence length 729
Comment pep:known_by_projection chromosome:TETRAODON8:2:6904704:6910233:-1 gene:ENSTNIG00000012840 transcript:ENSTNIT00000016025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHLLTFSLQDGDVQGVEEAQARLSFLAQNKKLWSQQMFLDVGAEAILLRDVQSLDELESY
AYKSIYRCDALNSEKHFPSLLLLVCQSAEQKKPDIHFFNCETVKAEQIRDDIAHAVADSS
KRRSKTAPDDLSIGDMIDPFDIPSPPIPHAPNPPPVNPPPYPGPREGEGVCISRIKGAVD
AEQRHEQKFNGGPEISFLRAEREVGILNHCFDDIENFMAKLQQTAEAATVLNQRKKKNKK
KSKKQSAEEDLLTAKARPPPEEEFVDIFQKFKYCFSLLARLKSAISNPSSEELVHHVFKP
LDMMVKTTGGPALGASVSSPALTNAAVTLLQDNLNQEERQLWTSLGPNWTLPRLDSVTRS
ALQGPPAAYVPVFLDGWKPETLRPDGQVWEDPVESQHKHEDLQVKMLHVVLSSIPSRAGL
CVLQQQQPPPQPVRPANTGSSDETRDGSPVPPERLYSCMYDFIARNSTELSVQQGETLEV
IESSKRWWKCRNYFNQVGFVPFNILQPTTHVESPVSSRPPSTRDLRPEHVTSGLNTLPPP
PQAPVPPALPKTFSIVPPSPPVLRPSDSPQRPRSLPPYSQHLPAADDTDSKGSRPSERVF
ALKVRLDVSQIMLVNDELLHRLTNGKANLSKPLVIQRASETSIPLDYDSSPEEVADWLRG
KGFSEPTVTCLGVLTGAQLFSLNKEELRAVIPEEGARVYSQLTVQKALLEDARRATELEE
VMEKQKMKV
Download sequence
Identical sequences H3D5M6
99883.ENSTNIP00000015815 ENSTNIP00000015815 ENSTNIP00000015815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]