SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015864 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015864
Domain Number 1 Region: 620-739
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000117
Family Pleckstrin-homology domain (PH domain) 0.051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015864
Domain Number - Region: 218-381
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000471
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 
Domain Number - Region: 992-1069
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0837
Family Regulator of chromosome condensation RCC1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015864   Gene: ENSTNIG00000012888   Transcript: ENSTNIT00000016074
Sequence length 1177
Comment pep:known_by_projection chromosome:TETRAODON8:2:6235528:6241757:1 gene:ENSTNIG00000012888 transcript:ENSTNIT00000016074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASLLWAVDVFGRVFSLSTAGQQWEQCRDVQMEFKRLAAARQCCWGIACDNNVYLNLHA
SDLPVRYQEESFENQRWNPVDGFSERLLPSDRWQWSDITGLQHQPLDSFQLPSSSWEWEG
DWYVDENFEGEPTEKEGWSYAVDFPATYCKDKRWNSCVRRRRWIRYRRYNAMDTWAKIPS
QHVTLPDPFSDISCGGWEISEEPRGRLSLWAVSLQGKVWFREGICFNNPEGSSWEEVPVP
GEVVQISSGPGDLVWAVLWEGQFIVREGIGRDCPRGTSWMTVDSPSSDVGATHVAVGSNV
VWALTKDNKVWFRRGVNSHNPCGSGWIGMVGEMMMITSGLNDQVFAITCEDRAVCFRQGV
TSSELSGKTWKAIGVPRDVDRAHSSASANSQQSAGCFFCDEVRGPASASDVESDTEKAPT
DGASRLISSASPESLIPVPTDVSVLPAETPKPRIPKVTSDSFISELVSDRDTATHPKESR
PAGPTVPENQSVGSDDPQWSNVDLAEAQGQQVQAGTAQDPGDSCSLSSVATYSLALEDLY
GADEHPLWAWVSGGGCDVDSHSQLNWFNSGMTNSCELIHGSVHLPAQTAAWRKQIFEQLS
ERTKREMENFRHYEQAIEQSVWVKKGSMQWWKDWKPHKWINVHFALEQFSGPEGNKDGIL
FVYYNFYEGEQYLHAFINEVTILVPVLSSDSKHTFAIYTPERTKQRWPIRLAAATELEML
DWLALLSVSCCDSRGIQGPPSRQAIWSITCKGDIFVSEPSPALEAIPYPTPSDQMFWRQV
GGHLRVVECNSLGIVWGIGHDHTAWVYTGGYGGGFFQGLASSTDNIYTQTDVKSVYIYEN
QRWNPVTGYTNRGLPTDRYMWSDASGLHECTKTNTKPPSLQWTWVSDWAVDYSVSGGTDK
EGWQYAADFPASYHGYKTMKDFVRRRRWARKCKLTTTGPWKEVPPIALSDVSLLPCAAQS
SVEVVPLWAISNKGDVLCRLGVTSLTPAGSSWLHVGTDQPFKSISVGAASQVWAIARDGS
AFYRGSVSPQSPAGDSWYHIPSPSRQKLKQVSVGRTSVHVVDENENLWYRQGVTPGYPQG
SSWEHISNNVRKVSVGPLDQVWIIADKVQGSHSLSRGTVCHRLGVQPLAPKGQSWDYGIG
GGWDHITVRGNSLEPPHIRLPSLTDPAPQAVHSPEVC
Download sequence
Identical sequences H3D5S4
ENSTNIP00000015864 ENSTNIP00000015864 99883.ENSTNIP00000015864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]