SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015868 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015868
Domain Number 1 Region: 247-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-41
Family Pentraxin (pentaxin) 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015868
Domain Number - Region: 18-48
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0549
Family I set domains 0.055
Further Details:      
 
Domain Number - Region: 129-220
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015868   Gene: ENSTNIG00000012892   Transcript: ENSTNIT00000016078
Sequence length 439
Comment pep:known_by_projection chromosome:TETRAODON8:2:6206429:6211213:1 gene:ENSTNIG00000012892 transcript:ENSTNIT00000016078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCLYGLLWFCAFGCGRITDAQVDDGKRYICRAVALSGDASCPVTLLPELSSGSQEEEL
RNTVMQLRETILQQKENISKQQGAINELTKKLSLCAAAADDKKYNKGSSWGKERQNTMGD
VPRDPNDSIESLGKTMQGLKDRLENLEQQQMRANMSGASFPTELRDLLQRRLGDLEKQLL
KKVSNLEEEKSVLSNATAAYRLKTESTLNALVDRISELEKGGGDVRSPEQFKLCLPQRTN
YLYGRITKSLPEMYAFTISMWIKSSASPGIGTPFSYGAPGQANEIVLIEWGNNPMELLIN
DKKVAQLPLDVRDGKWHHICITWTTRDGQWEAYQDGFKRGNGDNLAAWHPIKAGGVIILG
QEQDVVGGHFDAGQAFVGELSQVNIWDRVLKPAEIQSMANCSTYIPGNVVSWLATNVEVF
GRGAFKRPLEMCQDRLPNA
Download sequence
Identical sequences H3D5S8
ENSTNIP00000015868 99883.ENSTNIP00000015868 ENSTNIP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]