SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015909 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000015909
Domain Number - Region: 53-112
Classification Level Classification E-value
Superfamily C-type lectin-like 0.006
Family C-type lectin domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015909   Gene: ENSTNIG00000012929   Transcript: ENSTNIT00000016119
Sequence length 384
Comment pep:known_by_projection chromosome:TETRAODON8:2:5627774:5630549:1 gene:ENSTNIG00000012929 transcript:ENSTNIT00000016119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSGGGVPAAPPPTAAPTGPNISWIPEAPLLSQEQPIFLMTPAAQAVSGFFVWTALLLTC
HQIYMHLRFYSSPREQRHIVRILFIVPVYAFDSWLSLLFFTNDQYYVYFDTIRDCYEAFV
IYSFLSLCYEYLGGESAIMAEIRGKPIQSSCLYGTCCLRGRAYSIGFLRFCKQATLQFCV
VKPLMAAITVLLQAYGKYKDGDFDVASGYLYVTIVYNVSVSLSLYALFLFYFSTRELLSP
YSPTLKFLVVKSVVFLSFWQGLLLAILEKCGAIPQINSLEVSVGEGTVAAGYQNFLICVQ
MFFAALALRHAFPFQVYMDKSLDSQGRCAPMKSISSGLKETMNPGDVVQDAIHNFSPAYQ
QYTQQSTLERDTERTLLLSSDDEL
Download sequence
Identical sequences H3D5W9
ENSTNIP00000015909 ENSTNIP00000015909 99883.ENSTNIP00000015909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]