SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015927 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015927
Domain Number 1 Region: 230-514
Classification Level Classification E-value
Superfamily SPOC domain-like 8.83e-82
Family Ku70 subunit middle domain 0.0000000304
Further Details:      
 
Domain Number 2 Region: 9-229
Classification Level Classification E-value
Superfamily vWA-like 1.14e-46
Family Ku70 subunit N-terminal domain 0.00000085
Further Details:      
 
Domain Number 3 Region: 544-590
Classification Level Classification E-value
Superfamily SAP domain 0.000000000389
Family SAP domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015927   Gene: ENSTNIG00000012947   Transcript: ENSTNIT00000016137
Sequence length 594
Comment pep:known_by_projection chromosome:TETRAODON8:2:5463826:5467226:1 gene:ENSTNIG00000012947 transcript:ENSTNIT00000016137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLDYKVTGRDSLVFLVDASKDMFVRGEDGQPSNFDLTMQVVRSVYTSKIISSHRDLVAL
VFYGTEQSKNPSNSFKHVYVYHSLDEPGAKRVLEVDSLQGDKGARLMEETVGSGETSLGD
ALWCCANLYSDIKLRLSFKRLMIFTCRDQPHGGDAAKDRQARTKASDLKETGVIIDLLHL
MKPGGFDVSSFFCDIISPPSSEGELGLQLEPSDKLEDLRRRVRAKEQKKRALSRLNLCLG
EGVNVAVGIYTVAVPARVPAAIKLYRETNKQVQSKTRTFHTQTGSLLLPSEVKKAQVYGG
KQIVMERDEVDSIKKFEDPGLQLIGFKPLERLKIHHHIHPALFIYPEEDMVLALFSPSGS
SCLFSALLTKCIEKKVFALCRCVARRNSPPRFAALVPQREVLDEGKVQLSAPGFYLLHLP
YADDIRTLEPQPFPSASQVQVDKMKQIVSKLRFKYRSDAFENPVIQQHFRNLEALALDMM
APEDTEDLIMPKVDQINQRLGPLAQEFTELVYPAGYNPEIKPAPKRKSADNEGGAEKKPK
AEVSEEELRAHVQRGTLAKLTVPVLKEACKKFGVRTTGTKKQELMDALTARLGS
Download sequence
Identical sequences H3D5Y7
ENSTNIP00000015927 ENSTNIP00000015927 99883.ENSTNIP00000015927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]