SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015947 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015947
Domain Number 1 Region: 420-541
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-30
Family Cadherin 0.00081
Further Details:      
 
Domain Number 2 Region: 207-314
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 315-424
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 4 Region: 99-205
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-16
Family Cadherin 0.0087
Further Details:      
 
Domain Number 5 Region: 533-644
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000557
Family Cadherin 0.005
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015947
Domain Number - Region: 2-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.000493
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015947   Gene: ENSTNIG00000012968   Transcript: ENSTNIT00000016158
Sequence length 984
Comment pep:known_by_projection chromosome:TETRAODON8:1_random:1093927:1101851:-1 gene:ENSTNIG00000012968 transcript:ENSTNIT00000016158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQYRVWEEQPSGTRVGCLADDLRQSDEGGPFEDFQVVEHQKALPFSVSARDGVLSTQGRL
DREELCRGSDLCEVLLSVLYRRSGAMTCLRVRVEVMDQNDHSPRFPRAEQDLEISEMAGL
RMRIPERAVDPDAGPNGLQTYSLSVNQHFALDVAVGPEGSKQAELVIIKELDREVQESVE
LILVAWDKGDPPRSGSTSIHVRILDSNDNSPTFEDSSPTLELPEDTARGTTVIRLKATDP
DQGLNGEVAYSLSRHTRPEVQRLLAVDPQTAAVSLKAPLDYEVQSSYEVVVEARDRGPNA
VPAYCKLHIKLLDVNDNAPRILFIWDRPGSPGPTVLEGAPRDTFLSLVMVLDADSGRNGQ
VKAEILDGSGPFRLKHVQDGSYTIVTNGTLDREKVTHYNITLLARDHGDPPLSTLGQLTV
HVLDENDNAPVFSTSLYKASFEETNSTGYQVLKVQARDVDLELSGRVSYFIRNATRAQAA
TYFSVHPTSGLVRALRPLDYETSRSYWFLVEAVDQGHPPLSSTATVQIEIRDVNDNYPVV
KEPAPRRGVASLSIPVNADKEGRAAFLVSTIQAEDADSGLNGQLTYQLTRAEPNPLFWLD
AATGQLFVNTTNATQLIGQTFRLDISVSDGGRPSLSTGLTLEVTFINLRDHLKNSSPGAR
GQLSFAMMMAICLGATCLLLLLTVALVTTLCRPEKRDNRAYNCRQAESTYTRHPRRPQKN
IRKSDIQLIPVIRSRTLRLQAQPDGAEAPSPGQATLRRPRNSQRRGNEAERQRMLRDLVR
LSMAAFGDSIQLSSTSPEVQQISQLLSLLRQGQLQPRTNFRGNKYSHRRSVYGGQDCSDW
QSAKDSGRGESEAGDVDWEPGRDSPQLDEGLNHLLNHPDLKMDAAQTLLTPPLPADGFLP
DAGDPAWMARLSLPLAADYHDNVFIPNGPPSPEDAFLPRDVLDSSSSFSTFGKTPEKDGP
LGGALLSEVSTLFEMLMTQKADAH
Download sequence
Identical sequences H3D607
ENSTNIP00000015947 99883.ENSTNIP00000015947 ENSTNIP00000015947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]