SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015948 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015948
Domain Number 1 Region: 236-357
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 567-687
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 467-572
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 129-240
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.0025
Further Details:      
 
Domain Number 5 Region: 676-779
Classification Level Classification E-value
Superfamily Cadherin-like 5.56e-22
Family Cadherin 0.011
Further Details:      
 
Domain Number 6 Region: 369-467
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-17
Family Cadherin 0.0087
Further Details:      
 
Domain Number 7 Region: 26-109
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000857
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015948   Gene: ENSTNIG00000012969   Transcript: ENSTNIT00000016159
Sequence length 827
Comment pep:known_by_projection chromosome:TETRAODON8:1_random:1177495:1180972:1 gene:ENSTNIG00000012969 transcript:ENSTNIT00000016159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRRALTWLALFLVASCGAAAASTDILYRVPEEQPPNTLIGSLAADRGLPDTGHLYKLEV
GAPYLRVDGKTGDIYTTEVPIDRETLRDCRNPLAGDKCFLEFEVSITDMVKGLGSGPRLI
EGRIEVLDINDNTPQFSSPILTLSIPENTQVGALFAIPMATDRDAGANGVAEYTLTAGPD
ADQLFSLQVAVDSDEKVPQLVVMGNLDREKKDSYDLNIRVVDGGRPARASSALLRVSVTD
QNDNQPKFERSHYEAELTENSPQGYSVLQVRANDADTGINGEIDYSFHQASDTVQRLLRI
DRFTGIIYVKGQVDREEENFLKFFVAARDRGPNSKTSKVLVTITVKDQNDNSPSIEIRGI
GLVTHRNGVANISEDMPVGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESSNDR
KRKYFLQTTTLLDYERVKDYRIEIVAVDSGNPALSSTNFLKVQVTDVNDNIPIFSPPLLK
VDFAEGNYPGDKVLDVLATDADSGSNAELTYSISEPAALELFEVDANSGEVRVRAVLNRE
QREHYRFHVAAADKGVPGKTGTATVEITVLDVNDNDPKFMLDDYSFSVNENMAPLNPVGV
VTVTDGDKGENARVTLLVEPDNGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDAGDP
PRTSYVAVTINVLDENDNAPYVTKPSNSTFTHLLPDTPPDTRVAVVEAEDIDSGLNAELV
YTLAGGNPFGLFRIAPGSGEITLAQKLAGSHRGLHRLVVRVSDRGKPPRHTTALVHVFVN
ETKYNTSLIEALVGHSLYTPLDRDIAGDPDYALNHQSNILYGSLAGV
Download sequence
Identical sequences H3D608
99883.ENSTNIP00000015948 ENSTNIP00000015948 ENSTNIP00000015948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]