SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015949 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015949
Domain Number 1 Region: 1101-1225
Classification Level Classification E-value
Superfamily Cadherin-like 3.87e-32
Family Cadherin 0.00074
Further Details:      
 
Domain Number 2 Region: 130-245
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-25
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 775-888
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 881-996
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-22
Family Cadherin 0.00039
Further Details:      
 
Domain Number 5 Region: 1539-1692
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-21
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 999-1113
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 598-680
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 8 Region: 680-781
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 489-605
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000537
Family Cadherin 0.0026
Further Details:      
 
Domain Number 10 Region: 1387-1509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000554
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 11 Region: 12-104
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000145
Family Cadherin 0.008
Further Details:      
 
Domain Number 12 Region: 1772-1809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000272
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015949   Gene: ENSTNIG00000012970   Transcript: ENSTNIT00000016160
Sequence length 2077
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:34356405:34379229:1 gene:ENSTNIG00000012970 transcript:ENSTNIT00000016160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKGLAYMLLVVVQVTDQNDCTPEFLHAIYSRDGVPESVPAGTSLLQGIIKLRRSPPPRLR
GPQYTLNITATDDNASGGPFPLSSSAQVIVGINDVNNNKPVFLEVRGPRGRAPGVGPQGP
LPLLHLRLFPQCHNYSQRAVVLENQPPGTGVLRVQAQDADLGVNGQVKYGIMHRDGVSSG
FHIDPDAGYITTTVSFDRERQREFTLSVTATDQADEPLIGICQITVLVADQNDNEPKFEN
SRYQSTQEATPPAAEPDQESGGVRVKNGSKGDAGGIKEEANPSPGWRKTSCVKTLQWELV
SCERRHTMTTRAATRPSATPCPIRSRRTCTSTPAPAGSTSASPSHRCEPGAAGQAAPPPP
HLMAISSSSTSSPHGLFVLRSSLTVCPSSPGPPSPCLRLCSSTTTPCPIRSRRTCTSTPA
PAGSTSASPSHRCEPGAAGQPHACSSSSAASCRSSAQTSRIVRQIVASDGGNRSSSVELT
VFITNVHNQPPQWDQPEYWVTVPENTVRDAKIVTIKATSPLGDPRVTYDLEEGQVPETNM
PVRFYVKPNRADGSASILVAENLDFETTGFFTLRVRVQNVASVPLASFTTVYVNVTDVND
NVPFFLSSTYEATVPEGAQTGTSVAQVSAADLDSGPHGTVRYLILRDDSGDWRFFDIDSL
SGAIVSRASFDREQKASYLLESLYEVSVEEDKEVGFVIITVTANDEDEGANAKLRYQIAA
GNSMGAFDVEPEVGTIFVARPLDYEAERRYQLRLVASDGKWENETLVVVEVLNRNDEAPV
FSQSQYHAAVTEELSQLPVLILQVSATDPDQEADQGALRYSLHGQGAGGEFTVDQRSGSI
YAHRRLDREERPTWRFLVLATDEGGAGLTGFADVLLEVRDVNDNAPFFPCPALQAEGCFV
GRVAENSPADTSVMEMRATDLDDPNVGANAILTYSIIQNVRNQINLNLFSINGATGTIYT
VLRSLDREEAERHLVVVEARDGEGLAGTGTATIIVSDVNDHAPVFTQRLYSAQVTEDLEV
GSQVLVVSAMDQDEGQNAAVTFSIVGGDEDRKFFLETDRVNRRGVIRLQKKVDFEKPQER
VFNLTVKAEDSDFFSLSSCLVRVEDANDHAPVFSPQFYEAAALSEDTAAGTIVTQVTASD
ADSGQNGRLSYSISRQSDPLGQFLVDQSGWVLLAGSLDREKTSQHRILLLATDAGTPALT
GTAVLIVTVLDVNDNGPEFEAAYRPMPLLPPRLTLPLSSPPDRLFSRHGARTGGLPGPGR
LEPEGVPLGGKSPQLEAMLGVAISQVGVDDCPSTDCSRAGGCSSDVSFSQSPVALGAGEV
SLVSLSASLAARCGCRSREAVRMPCAAYAANPCLNGGSCLDGPLGHRSWPSRRTGCCCTT
DRLGSAHPGEPQDFVAIELKDGVPVLSVDHGSGTLTLQLRPAASLADRRWHRLDVSSDGK
AVDFVLDQCDGATVDEREAAASSRVDESSCRAAGETPGDQSGCIRNLVVDSQVYDLASPG
ESVDSWAGCRLTDGACVSGAGPSCGPRGSCVADWGSFSCHCGPGYAGLKCDAAVPEFSFG
SGSLLRLGLRGGGSSRHTSVQLLVRTRAPSGTLLAASSPSAREYVVLEVSEGHLSVRADL
GDGAHALRLTAHRLDMGQWVLVSLRRHDNLFTLQLEQGGASREVQARLGSHRKMVVDPGS
VTVGNGPQAANASRLSGVPAGRSLQRSAPPVGRPGPGPGGGAGEAGHRGGLPERRLQRWA
LQQPAALRGPLEEAPVQVTLTDASGQQSCRPSPCGPASCHNGGVCQATSADSFRCRCQEG
FRGQRCELGQVRGQQLAALSPSSILAVSMCLLLFLAVLVAVTVWNQKGSRSKFRKRGVYH
IPAEQQSWEDVRENILNYNEEGGGEQDQGFQGAAHLSPLIQRGYDITELKRPLCSSLSQS
SSCTTAPLIKSSPGSQEDVHPPGSSGGCPAPYLSVQPPGAYADHAAAHARFQTYVSRIVW
EADHDCQAFPPDSYHVWCVEGSGSPAGSLSSLGSVASRSNGPHGEEEEEEGPVRQRLSDW
GPKFQVLSDMYERPRRARTCPTAADVQRSHQLLPQQR
Download sequence
Identical sequences H3D609
ENSTNIP00000015949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]