SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015960 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015960
Domain Number 1 Region: 688-831
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-40
Family C-type lectin domain 0.00000487
Further Details:      
 
Domain Number 2 Region: 160-273
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-33
Family Link domain 0.0012
Further Details:      
 
Domain Number 3 Region: 266-367
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-26
Family Link domain 0.0045
Further Details:      
 
Domain Number 4 Region: 41-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000531
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 
Domain Number 5 Region: 832-890
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015960   Gene: ENSTNIG00000012981   Transcript: ENSTNIT00000016171
Sequence length 892
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:34442965:34447830:1 gene:ENSTNIG00000012981 transcript:ENSTNIT00000016171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCFLLRPGVAALLLAVCLLALPPSSTSRPESGEPRLLQVSVPTSPPVAAVLGANLTLPCL
VSLTHPPPTPVTNGRHAALSLPRVKWSILVNKEETEILVARGDQVQVSEAYRGRASLLYY
AHSPSDLTLHLQGLRRGDSGVYRCEVQQGLEEDGDVALVKVKGVVFHHRDAAQRYAFTFQ
RARAACQAIGAQMASPQQLLAAYHSGYQPCDAGWLSDGSVSDPIQTPGEACSPGMGGFPG
ARNYGPVEPDELYDVHCYVDDIAGEVFHGSAPQGLTFREATAFCRSHGAEVATAAQLYAA
WSDGLHRCSPGWLADGSLRYPAVTPGGRCGGAGPGVRSVYRHSNQTGFPEAHTRHDVYCF
REEPEPGDPAEQSGSAAEGSGSASASVQDLILLMKTSVFVTLPPSFVEGGGRSPEDVTFT
PVPPVQDLQGGSGEEPKLSVVLNTTHSDVEPRSPEGSGGSSGSSGGGWPEPTDLTPPSGD
DEAEEVRMTLSLHQTFTASCKPGSSSSCSPAVTEELIKETPSGFTSTSLGGKIKSSSSQS
CVCPPRPPPGPPQALITPVSRNLIQSFSSGKEPAAQTRRSPPAPHSPHAPATPAGASGAS
RSCRRPWPPRCLQPRETFQVPEPRRKEMTSAGPSGALTRCELVRGQPDLPNVSPSIFILL
VILVAADPCAENPCMNGGTCVDGGPGRCVCLPAYGGDFCQTDLQLCEPGWDKFQGFCYRH
VSSRQSWDAAEQHCRLSGGHLLSVMSPEEQEHVNEKYREYQWIGLNDRTIEGDFRWSDGN
PLLYENWLRGQPDSYFLSGEDCAVMVWHDGGRWSDVPCNYHLSYTCKKGASSCGDPPIVP
NARLFGKKRLRYETDALVRYYCEHGFVQTLRPVVRCLPSGQWEQPLITCRPR
Download sequence
Identical sequences H3D620
99883.ENSTNIP00000015960 ENSTNIP00000015960 ENSTNIP00000015960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]