SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015961 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015961
Domain Number 1 Region: 122-234
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-40
Family Link domain 0.002
Further Details:      
 
Domain Number 2 Region: 235-318
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-22
Family Link domain 0.0034
Further Details:      
 
Domain Number 3 Region: 24-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000612
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015961   Gene: ENSTNIG00000012982   Transcript: ENSTNIT00000016172
Sequence length 318
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:34448593:34449766:-1 gene:ENSTNIG00000012982 transcript:ENSTNIT00000016172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHRPVSAAAAGTLKYLLEPPVYAEVVAARGEDVALPCILRTKPSQYKVKWSKVEVETVER
EKVIIISSGDAYKTYGHLGRRASLRRAHVLDASLQLSRLELEDGGRYRCQLIHDLHDESV
LVALRIRGVVFPYQSKNGRYKLSYEEARRACVEQDGTLASQEQLYRAWTEGLDWCNAGWL
SDGTVQYPIIQPRPSCGGETSSGLRSYGSRDQEQNFDAFCFTSQTPGSVSFLPGSFSFQQ
AEKACRRGGAQLALVGQLYAAWRFHKYDRCDGGWLKDGSVRFPISNPRRRCGGLPEAGVH
SFGFPDETAHRYGAYCYR
Download sequence
Identical sequences H3D621
99883.ENSTNIP00000015961 ENSTNIP00000015961 ENSTNIP00000015961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]