SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016007 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016007
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-19
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 111-150
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000209
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016007   Gene: ENSTNIG00000013028   Transcript: ENSTNIT00000016218
Sequence length 151
Comment pep:known_by_projection chromosome:TETRAODON8:20:1895790:1896802:-1 gene:ENSTNIG00000013028 transcript:ENSTNIT00000016218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHYGCVEALLTWGADVDMDIPHLGTALYTACICQELECAGKLLREGANVQKGKSLDSPLH
AAAEKDCTDVVKLLLDFGADINARNTEFQRPVDVAPPSSLTEGFLLFYEATPRLLSQLCR
QCIRNCVGRDRLHLLAHLPLPTRLRNYLQYH
Download sequence
Identical sequences H3D667
ENSTNIP00000016007 99883.ENSTNIP00000016007 ENSTNIP00000016007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]