SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016010 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016010
Domain Number 1 Region: 1227-1566
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-25
Family NHL repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 922-998
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000432
Family Pre-dockerin domain 0.063
Further Details:      
 
Domain Number 3 Region: 663-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000662
Family EGF-type module 0.061
Further Details:      
 
Domain Number 4 Region: 1534-1676,1732-1749
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000863
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016010
Domain Number - Region: 798-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 732-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00276
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 597-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00368
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 632-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00733
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 567-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016010   Gene: ENSTNIG00000013031   Transcript: ENSTNIT00000016221
Sequence length 2761
Comment pep:known_by_projection chromosome:TETRAODON8:20:1916495:2024654:-1 gene:ENSTNIG00000013031 transcript:ENSTNIT00000016221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSQRDREIYCERDVDQEPRYTASTADREEGTCRVPTQKSYSSSETLQAFDHDPSRMLFGG
RVKEMVHKESAEYSRPGQTFSLRQFGICEPSARRGLAPCPETGPSHPLSSYCRGPAAAEN
HEPASPERTMTLWGAKSGQNSCLSSRSNSALTLTDTEMDNKSDNETGRKIKPSTCQQLIT
AESAPVSQPPPTKNQEPDMARNSWHKELNVNPSDFFSPQAKLLRIFQSSASICKPGPPPL
PPAPPPHRQHPSITSLSRSSLANQRSPSPPPTAGLAADLQSTAECVQLQDSWVLGSNVAL
ESRHFLFKTGTGSTPFFGAAAPGYTMATGTVYSTPARPLPRNTLSRGAFKFKKSPKYCSW
KCTALAAVGIAVVLSIVLCYCIAMHLFGLNWQLQELDNQQAFENGGTGKSGTTQSGIVTA
LAADGLRWSLENNSLDIGQVDVGKRVGQNVPPGVFWRSQLRLEQPCFLKFNISVQKNALI
GIYGRKGLAPTHTQYDFVELLDGSRLIAKEHRTPSELDHPVLVHQAGFIQYLDSGVWHLA
FYNDGRNVEAVSYNTIIQDSVTECTHNCYGNGECVAGSCHCFPGFIGPYCSRAACPVLCS
GNGQYTRGRCQCYSGWKGTECDVPASQCIDPQCGGHGLCVAGTCVCNTGHKGPNCDQVDC
LDPMCSGHGTCHHGECHCNPGWGGISCDILKSTCPEQCSSHGTFNTDAGVCICEANWTGA
DCSIAEVCVVDCGPHGSCIGGVCQCEEGWTGPECEQRDCHPRCIDHGCREGKCDCHQGWT
GEHCTIGEHTRDMLTDGCPGLCNNNGRCVLDQNVWHCVCQSGWRGLGCDVATEMLCSDGK
DNEGDGLVDCMDPDCCTQISCQGQTYCRGSPDPIAIASQSQGSAVQTSSRSFYDRVSFLI
GPSGSHVVPWDNVFNSSLVSVIRGQVLTGDGTPLIGVNVSFLHYPEYGYTVTRQDGMFDL
VANGGASLTLRYERAPFPTLHRTVWLPWNVFHVMDTVVMKREENDIPSCYLTGLIRPNPQ
ILATPLSTFYKSSPEDSPIVPETQVLHEQVAIPGSDLNLVYLSSRAAGYKPILKVLLTQD
RLPFGLMKVHLMVAVMGRQFQKSFPAFPDLSYTFIWDKTDAYNQKVFGLAEAVVSVGYEY
ESCLDVVLWEKRTAALQGYELDASNMGGWMLDKHHILDIQNGILYKGSGENQFISLQPPV
ISTVMGNGRRRSISCPSCNGLAQGNKLLAPVALAWGVDGSLYVGDFNYIRRIYPSGNVTS
IMELRNKDFRHSNNPAHRYYLATDPVTGQLYVSDTNSRKIYRPKSLSGTKDLQSNIEVVA
GTGEHCLPFDENHCGDGGKATEASLTGPKGIAVDKSGLIYFVDGTTIRKVDRNGIISTFL
GSNDLTSARPLTCDNSMDINQVILEWPTDLAVSPMDNTLYVLDSNIVLRITEYGQVSIAA
GRPPNCPHAGLERGVAGGQRALLTLLESAVSIAVSYHGAIYIAETDERKMSRIRKVTVDG
EIIHLAGAPSDCDCKNDANCDCYQTGDGYAKDARLNAPSSLVAAPDGTLYVADLGNIRIR
AISRNGPVLTSSAGTYEVASPDAQELYTFDSNGTHQHTASLLTGDLKYTFSYSTENDITA
VTDSSGNTLRIRRDSRTPVRIVAPDNQVIWLTMSTNGGLKTLAAQGQELVLLTYHGNNGL
LATKTSEIGWTTFYENSYDSEGRLMNVTFPTGMVNNLYTDIYSALTVDIESSLTEEEISI
TTNTSTIRAFYTLAQDQCRSSYQVGFDNSLRITYANGMDTHYQDRAAGLLIPTVARRNMS
LPGESGQNLVEWRFRKEQARGKINVFGRKLRVNGRNILSVDYDRTLRTEKIYDDHRKFLL
KIIYDTAGHPVLWVPSSKLLPVNVSRTSTGQISALQRGPTTERLEYDGQGRLVSRVFADG
KIWSYTYLEQSMVLLLHSQRQYIFDFDSLDRLAAVTMPSVARYTMQTIRSVGYYRNLYHP
PESNASVAVDYSEDGLLLRVAHLGTGRRVLYRYRRQNKLSEILYDSTRVSFTYDEAAGLM
KTVNLQNEGFICSIRYRQVGPLIDRQIFRFSEDGMVNARFDYTYDSSLRVTSVQGVINET
PLPIDLYQYDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRS
LMYWITFQYDDVGRVIKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKVMWRYTYDLNG
NLHLLNAGNSARLLPLRYDLRDRITRLGDIQYRMDEDGFLRQRGAEIFEYNSKGLLVRVY
SKSSSWTIQYRYDGLGRRVSSKSSLGQHMQYFYADLSYPARITHVYNHSSSEITSLYYDL
QGHLFAMEISSGEEFYIACDNTGTPLAVFTSNGLLVKQLQYTAYGEVYFDSNPDFQLVVG
FHGGLYDPLTKLLHFGEQDYDIMSGRWTTPDISTLKRIGKEPAPFNLYMFRNNNPISKVH
EVREYVADVNSWLVTFGFHLHNTIPGFPVPKFDLSMPSYELKKSQRWDDLPSISGVQQEV
TRQAHSLLSFERLPEVHLSRGHRGEKSWLWFSAAISPIGRAVMFAIYKGSVHTHTLNVAS
EDCIKVATILNNAFYLEDLHFTIEGRDTHYFVKPGLPDADLAALHLTSGHKTLENGVNVT
VSQSTTVMDSRTRRFADVEIRAGALALHIRYGSTVDEEKVRVVELARQRALTGAWAREQQ
RVRDGEEGVRPWTEGEKRQLLSSGKVLGYDGYYVLSIEQYPELADSSNNIHFLRQSEIGK
R
Download sequence
Identical sequences H3D670
ENSTNIP00000016010 99883.ENSTNIP00000016010 ENSTNIP00000016010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]