SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016033 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016033
Domain Number 1 Region: 2684-2972
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-115
Family BEACH domain 0.0000000323
Further Details:      
 
Domain Number 2 Region: 3040-3240,3420-3452
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-33
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 2530-2652
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-22
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 3460-3528
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1105-1244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000109
Family Trypanosoma sialidase, C-terminal domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016033
Domain Number - Region: 377-434,471-515,544-602
Classification Level Classification E-value
Superfamily ARM repeat 0.00036
Family Clathrin adaptor core protein 0.084
Further Details:      
 
Domain Number - Region: 1421-1473,1525-1586,1618-1716
Classification Level Classification E-value
Superfamily ARM repeat 0.000599
Family HspBP1 domain 0.047
Further Details:      
 
Domain Number - Region: 117-344
Classification Level Classification E-value
Superfamily ARM repeat 0.00137
Family MIF4G domain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016033   Gene: ENSTNIG00000015365   Transcript: ENSTNIT00000016244
Sequence length 3534
Comment pep:known_by_projection chromosome:TETRAODON8:12:3501098:3536855:-1 gene:ENSTNIG00000015365 transcript:ENSTNIT00000016244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFSELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPSTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEVNQSEET
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHMTEAPGHPPQELAPA
DRRALLQKVFVQILVKLCTFVSPAEELAQKDDLQLLFSAITSWCPPHNLPWRRSAGEVLT
TISRHGLSVNVVKYIHEKECLATCVQNMQQSDDLSPLEIVDMFAGLSCFLKDSSDVSQTL
LDDFRMCQGYAFLCDLMLRLEQAKEDESKDALKDLVNLVTCLTTYGVTELKPAGLTTGPF
LLPGFVLPQPSGKGHTVRNIQAFSVLQNAFLRAKTSRLACMLLDAIGNIYAADSANYFIL
ESQHTLSQFAERVAKLPEAQAKYFELLEFVVFSLNYVPCKELFSVSVLLKSSTSHACSIT
AVRTLLKLARHDPVFSDVLREVGLLEVLVNLLHKYAALLKDPAQQHPHNNDQADCKNNTA
AEEQKQLALLVMETLTVLLQGFNNTNAALFREFGGARCVHNIVKYRQCREHALLIIQQLV
LSPSGDDDMGTLLGLMHSAPSTELQLKTDVLRGQLFKVLRESHRTRTVFRKVGGFVYVTS
LLVAMERSLCQPPRHGWDRVNQNQVFELLHTVICTLTAAMRYEPANSHFFRTEIQYEKLA
DAVRLLGCFSDTKKLGPTSVFPSNAQPFQRLLEDEATTGGCAGDSVCPTLKHCSKLFIYL
YKMATDSFDSRAEQVPPCLTHETSLPSPWGTPALARKRHGYYGTTGSTAPVKALSDLKLH
VANTSHPISSSSLADTVVIHPGAVLAMLDLLPSVSSDSQPEHALDLQLAVANIQLLVNSD
RNQQVLCEACLHQRLARCSHALGDEDHPLHPPLQRMFERLASQALQPMALREFLRLGNPL
NCGAWDKKLLKQYRVHKPSSLGYDAEMRNSMTLSMEGFGPDSVFAAPAEDNGQYRISRSL
VRSPEGSTVPLTRVKCLVSMTTPHDIRLNGSAVTPAFVEFDNSLEGFGCLFLPSLAPHNA
PTNNTNASGVSDGAVLSGMGAGERLFPPPSGLSYSTWFCVERFSSAPQAHPVRLLTIVRR
ATTSEQHYVCLAVVLSAKDRSLTVSTKEELLQTYSDESSEEASFYEILPCCARFRCGEAI
AEGQWHHLVLVMSKGMLKNSMATLYIDGQLINTVKLHYIHSAPGGSGSTNPPVVSTVYGY
VGTPPAQRQISSLVWRLGPSYFLEEVLPATSVAAINELGPNYVGSFQAVYLPCKDSKAEV
SPASPVALVPEEKVSFSLCALSVSTLTVAKIRKVYNKLDSKAIAKQLAVSSHENATPVKL
IHNAAGHLNGPARTIGAAVIGYLGVRAFVTKPVATNLQYVGGAAAILGLVAMASDVEGLY
AAVKALVCVVKSNPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHE
TAIIPNSTAFQDLLCDFEVWLHAPYELHLSLFEHFTELLTESSEAAKNAKLLREFQLIPR
LLLTLRDTSLSQPTIEVTLTALFSTNERIIASHRLDSFGQFISSTLPTFAVCEKFVVMEI
NNEEKIDPGNDDDFGGLLSANLILLRNRLLDNLLRLLFTTKEKCSINAQACEELVRTLGF
DWLLMFMEEHLHSSTATAALWILVVLLSNQSILNRFREGLCGGGWLDHTDSVLTNKIGTV
LGFNVGRSAGGRSTVREINREACHFPGFPVLQTLLPKHTNVPELYFLLMALFLQQPVTEL
PDSLHIHIPRFLSICSLYFTFFDLDSIWTFIFGMPASSATVGSIHNVCTEAAFLLLAMLR
SMLNLPWQSEEEGSWLREYPVTLMQFFRYLYHNVNDLSPMWHSPEFLCALAAAVFPFNIR
PYSEMVSDLDDEAGSPIEEFKAFAGDSCMNRSQSEYCNVGSKTSLTNHPAKKYVFDFMRV
LIMDNLCMTPASKQTPIVDLLLEASPERSTRTQQKEFQSNILDGVMEHLLAADVLLGEDA
SLPLSSGGSYQILVNNVFYFTQRVVDKLWQGMFNKDSKLVVDFIVQLIGQSKRRSQGLSL
DTIYHCLNRTVLYQLCRPHKTVAQQVALLDALRVLTVNRNLVLGPGNHDQDFVACLAHCF
ICLHSGSSVEGFGLEAEARMTTWHVMMPTENEADATHSHDVSEGRQLLLKAVNRVWTELM
HSKRQMLEDIFKVSLPCNDRGHVDIATAKPALEEPALKSWQNHLVYEKKCVSRGEALAPA
TQSKLSRVSSGFGLSKLTGVRRNKKENSLNKNSLSAQETFQWMFTHIAVVRDLVAMQYKE
YQERQQNSLKYVTEEWASNEYELLRERGLWGPPIGSHLDKFMLEMTEGPCRMRKKMVRND
MFYIHYPYIPEIEPNTSTAQKPLRYRRAISYDSKEYYMRLLSGNPGMYQHSVEHSTEGET
THHEPEHGEDTIARVKGLVKAPLKRSRSTADGADEDNQDQLQEQLLESGGPEEEQRTDNT
SLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGYTMTVSREIRDIDTLPP
NLHEAIIPRGARQGQSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSADGRNYLLAFQ
KGVRNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEIS
NFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEELDLNNPKTFRNLAKPMGAQTDDRL
AQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASHRFSSDFRSNPHFSIYGGHFDLADRM
FHSVREAWFSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGAKQNGTKLADVILPPWAK
GDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPPAVEAVNVFHHLFYEGQVDIYN
INDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSKTNGDVTSVPPSSNSDKIFFHHLD
NLRPSLAPVKELKEPVGQIVCTDKGILAVEQNKVLVPPTWSKIFAWGYADLSCRLANYDS
DKALVVYECLSEWGQIVCAICPNPKLVITGGTSTAICVWETGPSKERAKSLMLKQALLGH
TDAVTCLTASSAYRIVVSGSRDRTCIIWDLNKLSFVTQLRGHRAPVSALCINELTGDIVS
CAGTYIHVWSINGSPISSANTFTGRSQQILCCCVSEMNEWDTQNVIVTGHSDGVVRFWRM
EFLQVPETPAPQPVEPEVPDCCGEEKIEGGETHNGDDDSSDSDGDEPSLNQEPKAPRNPS
TGGGSQPGSTVHRPRGPSTRAGASWSMDSSSDDSHRWSDTLSVDEKDGFVFVNYSEGQAK
VPHPHPSNPGQSSVSQPFQPSNTDARHYNQLRTGYRWERQLVFRSKLTMHTAFDRKDNAH
PAEITSLAISKDHSKILVGDGRGRVFSWSVSDQPGRSAADHWVKDEVVDNCSGCTVRFSL
TERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHELSAEGRN
Download sequence
Identical sequences H3D693
ENSTNIP00000016033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]