SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016046 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016046
Domain Number 1 Region: 63-208
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-40
Family C-type lectin domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016046   Gene: ENSTNIG00000013065   Transcript: ENSTNIT00000016257
Sequence length 208
Comment pep:novel chromosome:TETRAODON8:20:3184190:3188466:-1 gene:ENSTNIG00000013065 transcript:ENSTNIT00000016257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRIQYGRTGSLQPGHMPIILSGLNFLLIFTFIFSGISEGEAAFSALHQLKTENDRSERD
FKQLQHNLSSLKTEDVLCENNWKKFDLGCYFFSKLTKNWNQSREFCISKGGDLAVLNSKE
EQAFVNGWLKTSQNAWIGLFDIETEGTWKWVDGTVVTTTKCRKKYWQPGQPNSYGGNQDC
GEILQDSGGVGQWNDDACTADQTWVCEK
Download sequence
Identical sequences H3D6A6
99883.ENSTNIP00000016046 ENSTNIP00000016046 ENSTNIP00000016046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]