SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016051 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016051
Domain Number 1 Region: 2110-2236
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-34
Family Cadherin 0.00054
Further Details:      
 
Domain Number 2 Region: 3920-4128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 2630-2740
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-31
Family Cadherin 0.00033
Further Details:      
 
Domain Number 4 Region: 214-332
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-31
Family Cadherin 0.00052
Further Details:      
 
Domain Number 5 Region: 1276-1387
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-30
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 2323-2425
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-29
Family Cadherin 0.00081
Further Details:      
 
Domain Number 7 Region: 3048-3159
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 650-753
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 1905-2010
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 10 Region: 4144-4366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-27
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 3358-3482
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 12 Region: 1171-1282
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-27
Family Cadherin 0.00066
Further Details:      
 
Domain Number 13 Region: 1375-1503
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-27
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 1802-1911
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 2218-2329
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-26
Family Cadherin 0.0026
Further Details:      
 
Domain Number 16 Region: 3147-3257
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 17 Region: 438-549
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 18 Region: 2013-2114
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 19 Region: 542-649
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-25
Family Cadherin 0.00076
Further Details:      
 
Domain Number 20 Region: 1701-1808
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 21 Region: 951-1057
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 22 Region: 2827-2955
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.0033
Further Details:      
 
Domain Number 23 Region: 848-955
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-23
Family Cadherin 0.0026
Further Details:      
 
Domain Number 24 Region: 2936-3056
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-22
Family Cadherin 0.003
Further Details:      
 
Domain Number 25 Region: 2733-2831
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 26 Region: 2421-2527
Classification Level Classification E-value
Superfamily Cadherin-like 2e-21
Family Cadherin 0.0052
Further Details:      
 
Domain Number 27 Region: 3257-3362
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 28 Region: 756-852
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 29 Region: 3465-3585
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 30 Region: 2532-2636
Classification Level Classification E-value
Superfamily Cadherin-like 7e-19
Family Cadherin 0.004
Further Details:      
 
Domain Number 31 Region: 1484-1590
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-18
Family Cadherin 0.0032
Further Details:      
 
Domain Number 32 Region: 105-226
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-18
Family Cadherin 0.0029
Further Details:      
 
Domain Number 33 Region: 321-436
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 34 Region: 1055-1169
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 35 Region: 3770-3782,3813-3907
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000863
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 36 Region: 1593-1707
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000243
Family Cadherin 0.0028
Further Details:      
 
Domain Number 37 Region: 44-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000985
Family Cadherin 0.0065
Further Details:      
 
Domain Number 38 Region: 4392-4429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000028
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 39 Region: 3573-3665
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000989
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016051   Gene: ENSTNIG00000013070   Transcript: ENSTNIT00000016262
Sequence length 4943
Comment pep:known_by_projection chromosome:TETRAODON8:20:3288949:3396644:1 gene:ENSTNIG00000013070 transcript:ENSTNIT00000016262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRVWTLLLLWTLGRHSTSSQVRQEFQVLEEQPVGTYVGTIETKPSFTYRFSESHRLFSIN
GSSGVISTSAVIDREALQSDVINVVVLSSQPTYPTEVRIVVLDINDNSPVFPDASIVVSF
KEDASSGRQVILDTATDTDIGSNGVDHTTYRIVKGNEQRKFRLDITVNPSGEGAFLHLVS
TGGLDREVTPFYQLLIEVEDKGEPKTFGYLQVNVTIQDINDNPPSFERDLYQASVLEDAA
VGSSILQVTASDGDEAANAEIRYFLDEETPFQIDPKTGTIIIKEGLDYESRREYSLTIHA
VDNGVPSLSGRAEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDS
DSSAANGNISVSILGGNEQRHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGK
PVARSSFASLVIFVNDINDHPPIFQETEYRVDISEDIPKGSYIKGVSATDGDSGQNANLR
YSLVSGNALGWFSISENSGLVTSAALLDREATSEVVLNISAKDQGLQPRISYTKLIINIT
DVNDQVPTFTQSTFHVSLAEHAPAGTQLLVLSATDGDLGPNGTMRFSFDAETPAAAQGRF
RLDPLSGRLSTAVELDREEQASYLLHVQVTDGGSPPLRSAGKVNVTLRDVNDNRPVFYPL
QYFANVKENEPSGSYVTTVSATDPDLGRNGTVKYMITAGDAATFHINGNTGKISTLVPLD
REEKTTYQLQVTAADGSGLRSHTPAIVTVSVLDTQDNPPVFSQKGYSFVMFENVGVGTVV
GTVSATTVDLNTNVSYLITSGDQRGLFAVNSAGQITASSPIDREEQSFHQLKVVARAGQI
TGEVSVNITVKDLNDNAPRFIHAVEHVSAVENWSTGHTIFQAKASDPDEGANGVVVYSLK
QNPRGLFHIHEKHGLITLTGPLEVTASSYEVEVIAEDMGVPKHTSSLVLIVSVYDVNDNS
PVFDQLSYEVLIPESEPVNSRFFKVEATDKDSGFNGEIVYDIAGGNTGDVFGIFPDGQLY
IKAELDREIQERYNLVLVARDRAVEPLSASVNVSVILDDVNDNRPLFNSTNYVFHFEEEQ
QRGSLVGRVFAEDKDFGPNSEVRYTFEMPQPNFELNAITGELSSTAQFDRESLMRQRGAA
VFSFVVVSSDQGLPRPLKDQAKVQVYIQDINDNQPKFTKDVYQASVSESAPNVTQLLRVS
ASDVDENKNGLVQYHVAEGNEEGQFMIDSSSGQITLVGKLDYETTSSYSLKIIAVDGGAE
PLSSSCMLSISVLDENDNSPSFPKSSVSVDVLENMRIGELVASVTATDTDSGPNADITYS
ITATNNHGTFSISPNTGSIFLVKKLDYETQSVYKLNVSAKDNGRPSRSSSIPVIIHVRDF
NDNPPIFTPGDIFKSIPENLPVATSVMMIVAHDTDADINGQLEYSIVQQVPRGNHFSIDA
STGVLYTNQEVDREFSNLFELTVKATDQAVPLETRRFALKNVTIWVTDQNDNIPTFLSQN
ALVAEPNIMIGSILTTVVAYDPDEGANGEVEYELVEGDSGTFIMDRYSGDIRLASQLVPS
QLVYSLTVSATDHGTERKTSRTDLTIILQGLDGPVFSQPKYITILKEGQPPGTNVISLDA
SSPRGSTSKVEYFIVAVHSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDLYLVDVYAIE
SDASQPRTQRAEVEITLQDVNDNPPVFPNDILDVTIEENVGDGFKIMQLTATDADEGPNA
LVTYTIISGADDSFRIDPESGDLIATKKLDRERRSKYSLLVRADDGKQSSDMRLNITVKD
INDHSPKFSRATYSFDIPEDTTAGSIVAAILASDSDSGVNGEVTYSLEEDDEDETFLLNP
VTGVFNVTRVLDYELQRYYILTARAQDGGGQASTVRVYFNVLDVNDNPPVFETTTYSASV
SESLPAGSSVVTVVASDADDGPNAQLFYRIASGDPQGHFLITKDGNLRTQKALDRETQSF
YNLVITVNDLAPPPMTRFTSTAQVSVILLDVNDCPPTFTSQKMTYIQENTPVDTVVLAVH
ASDSDSGPNSYVEYSLHGPFSNKFSIGTIDGDVRLVGELDREEISNYTLTVVATDKGEPP
LSSTMDVTMVVLDVNDNTPSFSQNIYDIEIEENTLTGTDVIQVFATDADEGTNGQIRFSI
SGSNTDFRIYSVTGMISVARQLDREARSSYSLLVQATDRGSSPRMDQATVNIVLLDVNDC
APVFELSPYTVRVQENLENLPTNVLQVVARDDDQGANGQLSYMLSGGNDDGAFSLSSGGQ
LRLTQTVDREARGEYILLITATDSGVPSLSGTCMVTVFVSDVNDNAPVFSTSTFHTTITE
DAPTGTDVLLVNSSDADVGNNGVISYSLSGGHGQFSINPATGQIITSSVLDREERANYQL
LVVATDGGQPQGLSSSATVSVTVADINDNPPRFHHHPYVTHIPASTAAGSLVFAVTVTDE
DAGSNAQLHYSLIGRSSEKFKIDPIRGAITANEKLTGSSEVTLTVRVKDGGANPKTDMTT
VTVRFVTGGSFPVIKLKERAFTFPESQPANHIVTTVTGSSMRGGPLSYYIASGNLDHAFH
IDQLSGELSIRHPLDYEHIQKYVLWIEARDQGFPPYSSYEKVEITIQDVNDNYPVFEKDP
FQADILENLSPQRVLVVSAVDLDSGPNGQLEYSIVDGNKENSFSINRATGEIRTTRPLDR
EKVAQYSLKVKATDWGLPQKNMAVKVLINILDVNDNAPRFSKIFSATVAENAPVGYTVTR
VTTTDEDAGSNAVSRYSIADTSLPFSISPSTGDITVSRPLNREDTNHYIVRVSAHDSGWT
VSTDVTIFLTDVNDNAPRFSRPSYYLDYPELTEVGSLVTRVSATDPDEGFNGKIFYFIRS
QSEYFRMNASTGEIFKQPLKFQNSTAGSLNINRHSFIVTASDRAVQPLMSETTVIVNIVD
SNDNPPQFESPNYFTPVAKSVKVGTRLTRVVAHDKKDFGLNSEVEYVITGGNSSSKFQLD
KSSGWITVASSLISDVNKIFMVGITATDRGNPPLSGLTSLRIAVTEENHHTPEFSQSQVS
ATIPESLAVGTAIRTLSARDKDKDMNGVITYNITSGNDRGLFSINSRSGVLSLAGPLDFE
EKQQHNLRVSAIDGGWIAKTSYVSVTVHVTDVNDNPPVFEPDEYFPVVQENVPSGTTVVK
MNAKDGDSGANAVMAYVIQSSDSDLFVIDPNTGTITTQGFLDYEAKQVYHLTVKAFNVPD
EERCSLANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTVVGEVFASDRDQGDNGVVYY
LIFGKSRKKGFGINETTGQIYVTGALDREKEEKISLKVLAKNAGSIRGADIDEVFVNITV
LDANDPPVFTQELYDVQVSEGLSPGGLVTFVSAEDSDSVPSWSRFSYSIAPESDQKVFTI
NTKTGQVSVAAPLDRERTPVYNLTVLAVDTGTPPATGSATVIVNLEDINDNGPTLTTSYA
EVMENQRAGTAVTTLTASDADLPPNRGPFLFSLLSSGSANSYFSLSQSGALTTSREIDRE
QISDFYLSVVIKDAGVPQMSSTGTIHVKVNDQNDNPSEPRAVEIFVHYFGNMFPGGLLGD
VKPQDPDIQDRFHCSLIPPSSGIFSIPTGTCNLNSKARSTDGTFEITIRSSDGVHGSVSS
TARVLFMGFTNATVDNSILIRLQSQGVKSFLTNHYLSFLRIANSKLAGLGTGVLLYGAFE
LNNQTFLMAAVKRSHGQYVNPSGVATFFQSIKDILYRQSGVQIDAVDYDPCTHNPCQNGG
SCKRRLGVGPDMRSEESVPVILVFSRPLQPYACSCRPGYTGALCETDINECQPSPCHNGG
TCHNLVGGFSCTCPEGFTGMACERDVNECLSNPCKNGALCQNFPGGFNCLCKSGFSGKTC
DSIINHCECNPCFNGGSCQNRVDGYYCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNN
NYIYIKFATLKSDALLMYNHDNQTGDKAEFLALEILEGRVRFSFNLGSGTYKLMTMMKVS
DGQFHTVIARRAGMAASLTIDLCGDDQEPGYCAVSNVAVHTDWILDVQPNRLSVGGVRSI
EPVLHRRGQIATHDFVGCIMEFAVNGRPLEPSQALASHGILDRCPRLEGACTASPCRHGG
TCLDHWSWQQCQCVDGFTGRFCEKYVSVDTALSLDGTGRLDYALKQGPKRDTLLRRALAG
ATSEPAGPSRLEVKFRTRGKSGTLLHVQESSNYTTVKLRNGNIYYISDVGVLGKVERTIV
DALLSDGQWHTLQLVKNGSTTLLQVDDGHSRVIQHTTQDFGGLGVLTVSLGGIPPGPAQQ
KTAAGFDGCLAYLKYNGENLPFAGEHSLVTLTKTSSSVKIGCRGPNLCESNPCWDSLMCV
NQWYTYQCVPPGDCASNPCQNQGSCVPDPHSGFTCACSEFYTGKSCETLVACLGVQCPEG
TVCKTANNGAFVCSPNPTAETMVLPIWAVPAIVGSCATVLALVVLSLILCNHCKGRNKTK
VPKGSENVAFDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNNEAVP
SAPCAPCNGQEADIEHYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQS
PLPLGATSYTYQPQYTQALRSTPLSHSHSACPTPNPLSRHSPAPFTKPSTFYRNTPTREL
NLARREGSPLDLHNDMCQPPPMFNYATRLGRRSKSPQTMVSHGHASRPSSRLKQPIEQIP
LETGPPVGLSIEEVERLNTPRPRNPSICSADHGRSSSEEDCRRPLSRVRNPADGIPAPES
SSESDSHDSFTCSEMEYDREKPVSYSSRVPKLSQVNESDGDDEDYGGRMKQRRYSSRRAE
GGPGIAQMPPTDQHYTLPHKLGQQTGAFNWDNLLNWGPGFGQYVDVFKDLALLPENAAAK
DIEMNSGDGSVTILNEGEAEQYV
Download sequence
Identical sequences H3D6B1
99883.ENSTNIP00000016051 ENSTNIP00000016051 ENSTNIP00000016051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]