SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016062 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000016062
Domain Number - Region: 335-393
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0105
Family Ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016062   Gene: ENSTNIG00000013081   Transcript: ENSTNIT00000016273
Sequence length 790
Comment pep:known_by_projection chromosome:TETRAODON8:17:869261:879612:1 gene:ENSTNIG00000013081 transcript:ENSTNIT00000016273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTAANPADELLILYTANAYEWATYLQQILKVSRKFRKASVVLYAVSPADQLHGYNFEN
FQSCKCVLVLVSEELLNMLQLHEELQGGLHKLFYPPQRVVALLCGVSEEDVPRNIFEDWQ
SWRKVSTEDRPAVYISAIFKSVTEKEGVALVEETERVQEDEEQTRKDNLTKKETSATYNA
CLTIQPNRILCGEQEKLFIIFAHQLNIQASAEVEFLSENGDAKRVPGTLENEYTISVTSP
DMPAGVVSLTMYTDLSSVSLGPVTYYTSMGEVSRYLEKAVDPVTFLCQAFNLTSSMTESL
DDMLTESLKSKMPAPSFQLFGIRQIEEHNMESYQRKEELPTLLHFAARYGLKKLTTVLLQ
CPGALQAYSVMNKHGDYPNTLAEKSGFLDLRQFMDEYVETAAILKSHFEEAINTDEDAEV
YELMSATSEDIMMKYSSCSEDIYESMLGIDPECAEDLYEVMSAVNENPEEEHEESDHLKT
ETEEEEENEFLGVVEEEEDPYSLTPEDIYDTVDTNETYSPVSVIHNRPPAPIPRPEQEPK
PEQPVICRDHAGKTQKVPNKPFVSTHLAQPGVQPLSPVYDPFAGMKTPGQRQLISLQERV
KVGEITVDEAVQEFKAWQFDHKQRASSIRYQHENLKQLRESITRRHKERQKPGKELDYEI
SAPLQRSLYWGASVTPERAVYEPLPKAAPPPPNATPQVIQRDTWKTGSISSTSSTESNRL
STHSTFSYSSGTDPDFEDIAEISPPPPRPPRSPNAMALNSPPRIPPRIPESRGPAQSHQA
SPPPVPRRLR
Download sequence
Identical sequences H3D6C2
ENSTNIP00000016062 99883.ENSTNIP00000016062 ENSTNIP00000016062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]