SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016066 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016066
Domain Number 1 Region: 706-912
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-43
Family Protein kinases, catalytic subunit 0.00000571
Further Details:      
 
Domain Number 2 Region: 173-247
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000314
Family Cadherin 0.0049
Further Details:      
 
Domain Number 3 Region: 3-72
Classification Level Classification E-value
Superfamily Cadherin-like 0.00003
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016066   Gene: ENSTNIG00000013085   Transcript: ENSTNIT00000016277
Sequence length 1022
Comment pep:novel chromosome:TETRAODON8:17:973014:979354:1 gene:ENSTNIG00000013085 transcript:ENSTNIT00000016277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLYFSQSEYIETVYVGQPAGTPVLQVHALRDNVTELPHFYLCWVKFLRRPAYISWFSLDV
NTGVLYLNKTLEESDFASVCEPYTSNQSNQAVKKLSLHVMASPGFTKKPLCNSRNYPRIT
LDFVNAMMPQCGETDLKELCFPRKDTSNPHITENRFPGGLRQLRRLSWLNVCPNYTISYS
VETESPAPFAVNENTTELVVTAPLDREESESYRLLLVCTVRTEAVITKVETSLDVFVDDE
DDNAPYMNGTDTADIVISFNRTAGGSFGTLSVFDRDLTPIIDRTHNKYVGTLLNIDPWVK
ETFDIKGTFSEKKAAQGGIRETVHDYHLVLKRNLYVTENRTLQLDYLVNDTTYPGLEGTV
LLHFNVTILPVHIFFSNITHTFPLTRRASSYAQVGKVCVENCRQFDGFRIAYRLELPDKN
VSADVLSCHSAVSIAQAPDEMWGLLYVNDTEELRRPECQDLQYLVVVKEQHTQMETSVQI
QIILDNEVGQESQPLLSCAENRRRGDCESARGLGTTTGRCQWRQGSDKGISKNYSTCSPD
LRTCPDSVCDAVESKDASICPQDCTSKTILNIRTLIQGTCEHGRSHHFILWLLIVVKEKT
VIGGHEPGLRNGIQAGHGTCYCYSEKCFCEKEDIDETMCDDMCKTIIATALLLSFIVSIL
LSSYFIHRYHKNSPKPPIASAEMTFRRPAQAYPISFPANNLRRGSQESIETDTFKIPEDP
KWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASHSELRDLLSE
FTLLKQVNHPHVIKMYGACSQDGPLYLIVEYAKYGSLRNFLRESRKVGPSYMGRDANRNS
SCWSFGVLLWEIVMLGGNPYPGIAPERLFNLLKTGYRMERPENCSEEMYNLMLRCWKQEA
DKRPTFSDISKELEKMMVKSRDYLDLAASTPADALLYDDALSEEDTPLVDCNNAPLPRTL
PSTWIENKLYGMSYPNWPEKSPVPLSRHDATNPVFTRYANDSVYANWMALPSPAKAVDKV
DS
Download sequence
Identical sequences Q4S3R8
ENSTNIP00000016066 99883.ENSTNIP00000016066 ENSTNIP00000002538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]