SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016079 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016079
Domain Number 1 Region: 692-1041
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.07e-119
Family Hect, E3 ligase catalytic domain 0.000000115
Further Details:      
 
Domain Number 2 Region: 2-345
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.84e-101
Family Regulator of chromosome condensation RCC1 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016079   Gene: ENSTNIG00000013098   Transcript: ENSTNIT00000016290
Sequence length 1047
Comment pep:known_by_projection chromosome:TETRAODON8:17:1073819:1086295:-1 gene:ENSTNIG00000013098 transcript:ENSTNIT00000016290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGNASYGQLGLGGIDEEIVVEPRKCEFFHGKRVCDVGCGLKHTVFLLDDGTVYTCGC
NDLGQLGHEKSRKKPEHVVALDAQIIVAVSCGESHTLALNDKGQVFSWGLGSNGQLGLNN
FEECVRVPRNIKCLSDVQIAQVACGYWHSHALSKGGQVFSWGQNQFGQLGLGMHGSSIST
PQIIQSLQGIPFAQLSAGGAHSFAITLSGAVFGWGKNKFGQLGLNDTKDRWFPALLKSLR
SQRVIFVSCGEDHTAALTKEGGVFTFGAGGYGQLGHNCTNHEINPRKVFELMGNVVTQIS
CGRQHTLAFTPSSGKMYSFGLGGNGQLGTRSACNRKSPAPVKGPFVASGAPVESESEQCY
CIHRISVFKQGSSHYLCLPLMSCIKPQTITDLKSHRGICTISEESIQKWLSHSSGRLSLE
ISSEIDLVFSSASCLNGSFLSTSNPDHFSTSSKFSGVDVNLARLLFHKVFQHNHPEITQL
IAASLEKNLLPRLSSTPPDIESLRLYLTLPECPLFSDQNNYVTITIPFAKSVVSLKDAAL
KVLGNWWSTFEVAVFRLAELYKKVVVYLLRMHKLGIPSVEQRIFNCFLDTSLRFLEILHA
VNEKAGHIIEYDKFYIHELDDLVDIRNDYITWFQRQMFPTQGPDGLVTLCRYPFVFDAQA
KTTLLQTDAVLQMQMAVDQAQMQNLSSLFMPVESVNPCLILIVRRDNIVGDTMEVLRKSK
NVDYKKPLKVIFVGEEAVDAGGVRKEFFLLIMKELMDPKYGMFRYYEESRLIWFSHKTFE
EFDLFNLIGVICGLAIYNLTIVELQFPVALYKKLLKKKPTLDDLKELMPDVGRGLQALLD
YTEDDLEEIFCLNFTITEENYGATEIIELVPNGEKISVTKSNRQEFVNAYVNYVFNTSVD
PLFEYFYAGFHKVCGGKVLELFQPNELQAMVIGNTNYDWTDLEKSTEYKGEYWKDHPTIK
LFWEVFHNLPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQPTGGGEHYLPVAHTCFNLLD
LPKYTSIETLREKLLQAIDHNQGFNLA
Download sequence
Identical sequences H3D6D9
ENSTNIP00000016079 ENSTNIP00000016079 99883.ENSTNIP00000016079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]