SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016087 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016087
Domain Number 1 Region: 254-371
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 153-258
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-27
Family Cadherin 0.00068
Further Details:      
 
Domain Number 3 Region: 356-483
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 41-147
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-17
Family Cadherin 0.0039
Further Details:      
 
Domain Number 5 Region: 596-722
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 6 Region: 473-569
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016087
Domain Number - Region: 2-53
Classification Level Classification E-value
Superfamily Cadherin-like 0.000114
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016087   Gene: ENSTNIG00000013106   Transcript: ENSTNIT00000016298
Sequence length 1121
Comment pep:known_by_projection chromosome:TETRAODON8:17:1196095:1204937:-1 gene:ENSTNIG00000013106 transcript:ENSTNIT00000016298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVQNPINREQVATFEIIVSVHDNASEVIDKSGSVPNARLTINVLDVNDNAPRFRPFGVSN
FTEKLEGAQEGTTLLSVSAVDPDKGANGHVVYQLLHLPAGYVRLEDPSTGKIVANQTVDF
EQVQWLNFTIQARDHGSPPRIAELPVLRIVDVNDNNPVFLQPSYQEPVFENVALGTTIVR
VSATDADSGLFAAIEYSLVDGEGKFAIRPSTGEIYILSPLDRETKDHYTLTAVARDNPGG
SPNNRRENSVQVLVTVLDVNDYRPRFTERTYNTSVFENEPSGTSVITVSATDLDEGENGA
VLYRMLGPQSEAFTLDPNTGLVRSRRLLQSSERFNLTVVATDQGRPPLWGTADLIITVID
VNDNRPVFVRPANGTIIHITEEQPPGLPVYEVHATDADEGVNGEVRYGFLQTGASNRDWE
NFHIDAISGVITTTVKLDREKQALYSLIIVARDMGQPVPYETTQPLQVALLDIDDNEPVF
LKPPRGSLPYQKLTVLEHSPPGTVVGNVTRAVDADEGANAVVYYFIAGGNSDGNFGLSLD
GELKVYKDLDREEIPVYSIIIKASSNKSWTPPRAQRAARTSALDPGLDPSLLEVRIELED
INDQTPRFTKMEYTAGVASNAKVGSELIKVAAIDNDVGNNSVVQYHIVTIRYFQSQSNGS
EDMGNIFTIGLRDGIIRTYDLFTAYSPGYFQLEILACDFAGHSTTTNVNIYILRDDQRVK
IVFNEIPDLVRENQEEFVGLLSNITGAIVNMDDIQFHVDKKGRVSYAQTDMLIHVVNNQT
NTILDVERVIQMIDENKEQLRNLFRKYNVVDVQPAISDKLPDDITTLQLVIIILAVLLCL
AGICFVTMNWHYRRVHQRKLKAIVAGSTGNQGLMDILDMPNTNKYSFEGANPVWLDPFCR
NLELANQADHEDDLPENLSEITDLWNSPARTHGTFGREPQAKPEDDRYLRAAIQEYDNIA
KLGQIMREGPIKGSLLKVVLDDYLRLKKLFAARMVTASTSQGDGSSVTELIQSDLDDDED
ERLGMGGGRGTLRFKHKLPVELKGPEGVHVVHGTGTLLTSDLNSLPEDDQRALGRSLEAL
NADGGLYSEHNARTESAKSTPMHRHKDGEVLSESPLEITEL
Download sequence
Identical sequences H3D6E7
99883.ENSTNIP00000016087 ENSTNIP00000016087 ENSTNIP00000016087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]