SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016122 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016122
Domain Number 1 Region: 11-97
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000793
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016122   Gene: ENSTNIG00000013140   Transcript: ENSTNIT00000016333
Sequence length 592
Comment pep:known_by_projection chromosome:TETRAODON8:1:7284063:7287825:1 gene:ENSTNIG00000013140 transcript:ENSTNIT00000016333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKRTSMAQEAFPLHFLVWNNQYLELDRELQKKEDVGRLDPRGRTPLELAVCLGHLESTRV
LLRHSSDPTHCNAQGWTILQEAVSTGDPELVQLVLQYRDFKRATERLAGIPELLSKLRQA
RDFYVEMKWEFTSWVPLVSKVCPSDVYRVWKSGSCLRVDTTLLGFEHMTWLKGRRSYIFK
GEDDGAVVMEVDHEKQVVYTEPLVLSPRDAPSLLAAMQPSQENTAQRLTSPIVSTHLNTR
NISFERNKSGIWGWRSEKTEVVSGYEAKVYSATNVELVTRSRTEHLSDQDKLKSKGSRTP
LQSFLGIAEQHTTHNGSNVSQCASPHNPTAITAEEYFDPEFQLNGRDIGRPVELTSKVQK
FKATLWLSESHPLSLAEQVTPIIDLMAISNAHFAKLRDFITLRLPPGFPVKIEIPLFHVL
NARVTFSNLCGCDEPVASVTVHRLEGSDKAGHSPPPFLCEVDPSVFEPPADYTTLGPGRS
EPMRDEDDNLLQFAIQQSLLDAGTESDQVTIWEALTNSRPVLQSPLYEEDSQLESAVTES
PLSGHFGVASSYDEQLRIAMELSCREQEELDRQQKAEEEELERILQLSLTEK
Download sequence
Identical sequences H3D6I2
ENSTNIP00000016122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]