SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016162 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016162
Domain Number 1 Region: 30-493
Classification Level Classification E-value
Superfamily Sema domain 1.83e-154
Family Sema domain 0.000000000557
Further Details:      
 
Domain Number 2 Region: 496-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000123
Family Plexin repeat 0.00075
Further Details:      
 
Domain Number 3 Region: 545-624
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000108
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016162   Gene: ENSTNIG00000013179   Transcript: ENSTNIT00000016373
Sequence length 757
Comment pep:known_by_projection chromosome:TETRAODON8:1:12897164:12901777:-1 gene:ENSTNIG00000013179 transcript:ENSTNIT00000016373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSLLAGLMLHVSSSALNPHQGVPRKSVPYQNEYKVFREEGIFNYSTMLMRDDLGLLLLG
AREAIYALDINDISVKKAAVYWRVPEEKQRECTYKGKQAEVECRNYIRTLHKVNDTTMYV
CGTNAFSPTCDYMTFVEGRLRLEGKQEKGQGKCPFDPFQRYSSLMVGNDLYSATSINFLG
SEPVVLRSSDLALRTEFKSSWLNEPNFVYMDVVSESVDSPDGDDDKVYLFFSENAVEYDF
YTKVAVSRVARVCKGDVGGLRTLQRKWTSFMKARLDCSFPELSLPPIVQDVFLLKDDDWR
RSVFYAVFTSQSVLSQLSTVCAYSVTDIADIFNQGKFKTPVAVETSHVKWVMYTGEMPVP
RPGACINNAARNMGMNRSLDLPDKTLQFIRDRPLMDEAARPLTGGPLLVRRGPLLTRIVV
DSVLALDGQRHAVMFVGTENGYVQKAVNYDGEMFVIEEIQVYEDPLPVTTLSLSASKGQV
YAGSEGGAVQVPVCTCGRHGACVDCVLARDPYCAWDLASGRCVSVRDPSGPAVQSLREGD
VSQCPEPDLIAAVDVVLVPGNNVQLPCQVHSNLAEVLWHFSNQTLRSSHKYYIYSGGLLL
ANASEADAGAYACYSVERVGARTFTQTVALYRLGLKSASGETQSDPGRVTRLEVAVALLS
LLCFSLIGFIFWNWIQGRLACFRPASQRPVQAEAPRPSGEYTHIPTRPSQVKLPQRPFRA
NNNHSAVDFQRSEERRLTPANASTLNGLGYINDESEI
Download sequence
Identical sequences H3D6M2
99883.ENSTNIP00000016162 ENSTNIP00000016162 ENSTNIP00000016162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]