SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016163 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016163
Domain Number 1 Region: 327-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-28
Family SPRY domain 0.0025
Further Details:      
 
Domain Number 2 Region: 160-269
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000014
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016163   Gene: ENSTNIG00000013180   Transcript: ENSTNIT00000016374
Sequence length 492
Comment pep:known_by_projection chromosome:TETRAODON8:1:12910397:12914748:1 gene:ENSTNIG00000013180 transcript:ENSTNIT00000016374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEQKESLRKITHTLALKNEEISNFVCTLKQSLENLEANANRVQEDLESEFNSLYSVLEE
MKENMMTRIKQERAGRTYELQQSQLSACSKALESSEELLELANQALCSSETNAFTQQAAK
DIKDSVTMAPAFRLSLKAKASDNMSHLMVDFSQERSVLQGLKFLPVPATPEIQISDCQVC
DNTVTVVWTLPEPDGKIDHYILEHRRTNHEGPPRIREDYPWMVVEGIRETEHTLTGLRFD
TRYMTFRVKACNKAVAGDFSEPVTLETHAFSFKLDCSSSHQNLRVEDMNVEWDGSGGKQD
IRKEKNRTNSPMHSPARSALMSPKRAPTTRPGRDRFTAESYTVLADTAIDAGQQYWEVRF
DKESKAFAAGVALRSLGRFDQLGKSGASWCIHLNNWLQQTDGQAQQQGRALDCPIPSSIG
VYVNYEEGVLSFYNAKTKQLMHTFKTKFQQPVIPAFMVWNGSFSVVTGLQVPSVVQSSQR
RNSTSSSNASLT
Download sequence
Identical sequences H3D6M3
ENSTNIP00000016163 ENSTNIP00000016163 99883.ENSTNIP00000016163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]