SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016175 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016175
Domain Number 1 Region: 857-1009
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-44
Family C-type lectin domain 0.00000662
Further Details:      
 
Domain Number 2 Region: 86-199
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-39
Family Link domain 0.0018
Further Details:      
 
Domain Number 3 Region: 200-304
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-28
Family Link domain 0.0045
Further Details:      
 
Domain Number 4 Region: 1010-1070
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000973
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000997
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016175   Gene: ENSTNIG00000013192   Transcript: ENSTNIT00000016386
Sequence length 1075
Comment pep:known_by_projection chromosome:TETRAODON8:1:13049524:13107531:-1 gene:ENSTNIG00000013192 transcript:ENSTNIT00000016386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRVKWTKVWGQRGSDGLQKEQSVLVARDNVVKVKKAFQGRVTLPGYSANRYNASLALSGL
RSSDSGLYRCEIVVGINDEQDTVPLEVTGVIFHYRAPHDRYGLTFADAKRVCLENSAVMA
TPGQLQATFADGYDNCDAGWLSDQTVRYPIQSPRPGCYGDREDSPGVRNYGVRSPDELFD
VYCFAKQFQGEVFHSAVPEKLSLATASTHCRSLGAQLATVGQLYLAWQAGLDQCDPGWLA
DGSVRYPINVPRKNCGGDEPGVRTVYNNPNRTGFPDTTALFDAYCFKASDTPTLSTTAPQ
SPHTQTSNSVLADIVESLMRPFRYWTGDEETQKEASHFGATAGEGQIEASTRSPTLSRAS
GNKGDTDNAIKEQTSHTLSFGPPVAGIQSPHEGLSEQEKEAIPPNPQASTVHKTAQTFCK
VPENCRDNSVINHKITTSLFFVSLQSSRQHVPEVSDSTAEALMEVLTTSDMTTVEHLPTR
DSQDVDPTMTASTTEESPGGAPTDEPSISISWVREDEGIYLIRYATCSLSRPPSAPALPY
PCLSLTTLLTSNIKNLHFPVLRVAQTSGGISNTAGIPQPNEIRVQQQGLEDQVTQSSHYG
SNHFTQKHKEQNKTVVPLKQQNLAKNRFSLSQPPAINNKTPCCRGSRWKSSFQTEVFSSF
ILHSLSRSEVLTAERSGSREGGLPATVSSYHEAAALLRVEGACSRRTFQTHPEQRSVSLT
VTSTRFLYSCASQQKSDALKTSKQQVEQLSDVCSLKRPQSKAENSLSSSPLGCCSTLTVK
GLSPIYLFFLHNASASPSSSSSSATTRQLSRWLAPVYRITHSLPTNKWSSGNACQNAYIN
DAYIDDCHSNPCQNGGTCIDEINSFVCLCLPSYGGATCEKDTEGCDHTWRKFHGHCYRYF
SRRHTWEDAEKDCREHNGHLASIHSPAEQNFVRGLSHDNTWIGLNDRTVEDDFQWTDKMD
LQYENWRENQPDNFFAGGEDCVVMIAHENGKWNDVPCNYNLPYVCKKGTVLCGAPPPVDN
AFLIGRKRSHYDIHSVVRYQCIEGFLQRHVPTAKCRANGKWDRPKIICIKCEFLS
Download sequence
Identical sequences H3D6N5
99883.ENSTNIP00000016175 ENSTNIP00000016175 ENSTNIP00000016175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]