SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016177 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016177
Domain Number 1 Region: 55-191
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.15e-35
Family Ankyrin repeat 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016177   Gene: ENSTNIG00000013194   Transcript: ENSTNIT00000016388
Sequence length 198
Comment pep:known_by_projection chromosome:TETRAODON8:1:13157236:13158274:-1 gene:ENSTNIG00000013194 transcript:ENSTNIT00000016388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHPTSLTNKQRGNEVTLLPASIDSLSIHQLAAQGEVSEVAAHLSKVSHVQLYLCVIFADG
SLLNNQDERGFTPLMWAAAFGEKTMVDFLLDKGADPKTIARERESALTLASSGGYVDIVE
SLLRQGADINTYDWNGGTPLLYAVRGNHIKCVQALLASGADMTIESESGYSPMALAFALG
HKKIQKVLENHILKLYKS
Download sequence
Identical sequences H3D6N7
ENSTNIP00000016177 99883.ENSTNIP00000016177 ENSTNIP00000016177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]