SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016194 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016194
Domain Number 1 Region: 15-104
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-21
Family Ankyrin repeat 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016194   Gene: ENSTNIG00000013211   Transcript: ENSTNIT00000016405
Sequence length 112
Comment pep:known_by_projection chromosome:TETRAODON8:4:1065051:1065389:1 gene:ENSTNIG00000013211 transcript:ENSTNIT00000016405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQADVSTCSAPQRVFQEAVKKGNTKELHSLLQNMTNCEFNVNSFGPEGQTALHQSVIDG
NLELVKLLVNFGADIRLANREGWSALHIAAFGGHQDIVLYLITKAKYSSGAR
Download sequence
Identical sequences H3D6Q3
ENSTNIP00000016194 99883.ENSTNIP00000016194 ENSTNIP00000016194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]