SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016205 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016205
Domain Number 1 Region: 196-307
Classification Level Classification E-value
Superfamily PX domain 1.83e-28
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-16
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016205
Domain Number - Region: 338-533
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0241
Family BAR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016205   Gene: ENSTNIG00000013223   Transcript: ENSTNIT00000016417
Sequence length 536
Comment pep:known_by_projection chromosome:TETRAODON8:4:915156:918535:-1 gene:ENSTNIG00000013223 transcript:ENSTNIT00000016417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRARVLYDFSSENPGEISISENEVVTVYSEQELEGWLEGENSRGETGLLPASYVEIIR
THIPSGSSNNGLSVPKANSQACTSPDPQEGFHTSQGSDDDWDDDWEDSSPASNAPRGLGG
VPALYPVTSSLPGRRDSAQQQQQAKSSATVGRNLNRFSTFVKSGGEAFLLGEASAFVRDG
DRICLALGKHGPEWQENPYPFTCTIDDPTKQTKFKGMKSYMSYGLTPTHTNVQVNRRYKH
FDWLYARLVERFPVISVPHLPEKQATGRFEEDFIAKRRKGLIWWMNHMTSHPVLARCDVF
QHFLTCGADEKAWKQGKRKAEKDELVGANFFLTISTPSVPLDLQEVESKIEGFKTFTKKL
DENIVVVNTTIIEFARKQATGFKKEYQKVGQSFKLLAQAFELDQQAYSAGLNRAIAGTGD
AYEAIGDYFAEQPRQDLDPISDLLDFYRGHLANFPDIIHVQKGALTKVKDCPKQESELHD
RCNIISCATLAEIQHFHRTRIRDFRSQMQHHLRQQIDFFQKITTKLQETLQKYDDG
Download sequence
Identical sequences H3D6R4
ENSTNIP00000016205 99883.ENSTNIP00000016205 ENSTNIP00000016205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]