SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016208 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016208
Domain Number 1 Region: 19-197
Classification Level Classification E-value
Superfamily vWA-like 1.45e-35
Family Integrin A (or I) domain 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016208   Gene: ENSTNIG00000013226   Transcript: ENSTNIT00000016420
Sequence length 471
Comment pep:known_by_projection chromosome:TETRAODON8:4:875091:879894:1 gene:ENSTNIG00000013226 transcript:ENSTNIT00000016420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLLVAVGASLRHDDDASCDGAFDIYFVLDRSGSVSGHWPEIFGFVEQLTGRFVSPRMRV
SYIVFSARAVVILPLTGHRAEIDEGLERLRQIKPAGETFMHEGLKAVSGQMKAQTSPSSS
IVIVLTDGKLEVYPYELSVQEADRARGLGARVFCVGVMDFDHKQLAEIADGPERVFPVLS
GFHALKDVVATILTQSCADVFTIEPSSVCVNESFDVALRGRGFSGSKRTDGVLCFLTVGQ
KTYDQKPTVVGDGHLLCPAPVLHEVGQSLEVRVSLNNGKSFISSSVSIYATTCSDGSWVL
WLLLALLLLLVLVLLWWFWPLCCTLVIRDPPPSRPPPPPPVIDPEEDPLPKHRWPTVDAS
YYGGRGPGGIKRMEVRWGQKGCTEEGARLEKTKDAVVTMPEDVDEPIVRRPPPRPPPVYN
PQAQDKWYTPIKGRFDALMALLRRQYDRVAIMRPTSQDKGRCINFTRVQSR
Download sequence
Identical sequences H3D6R7
99883.ENSTNIP00000016208 ENSTNIP00000016208 ENSTNIP00000016208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]