SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016214 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016214
Domain Number 1 Region: 604-917
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.56e-70
Family Ankyrin repeat 0.00000621
Further Details:      
 
Domain Number 2 Region: 148-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.84e-58
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1085-1288
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.73e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0016
Further Details:      
 
Domain Number 4 Region: 493-632
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-28
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 5 Region: 1005-1067
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000373
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016214   Gene: ENSTNIG00000013232   Transcript: ENSTNIT00000016426
Sequence length 1306
Comment pep:known_by_projection chromosome:TETRAODON8:4:799303:820714:1 gene:ENSTNIG00000013232 transcript:ENSTNIT00000016426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASPPRGSSLPGSPPGSPSGPADDAPLPPRGATEEAAEGAESPDSPSTAAARLRAPGPRA
AAPSRSLPTPAVTSGPPGSPSGPADDAPLPPRGATEEAAEGAESPDSPSTAAAGSSSGGS
SPTTPESSSVSSPDSGAGTPGSGAFRELFEACRNGDVSRVKKLVDGVSVNAKDLAGRRST
PLHFAAGFGRKDVVDHLLCTGANVHARDDGGLIPLHNACSFGHSEVVSPLLCKGPTPTPG
TNWNYTQLKEAAHKGQRCEELSCCVCLPSPTVLLQHGAEPSIRNTDGRSALDLADASAKA
VLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLL
LQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRV
EVCSLLLSHGADPTLLNCHSKSSVDMAPTPELKERLTYEFKGHSLLQAAREADVAKAKKS
LVLEIINFKHPHTHETALHCAVASPHPKRKQVTELLLRKGASVNEKNKDFMTPLHVAAEA
HNDIMEVLQKHGAKVNALDTLGQTALHRAAMAGHLHTCRLLLGYGADASLVSLQGFTAAQ
MGNEAVQQILSENVPVRNSDVDYRLLEAAKAGDLDTVKSLCTPQNVNCRDLEGRHSTPLH
FAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLW
KFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLD
AAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKG
GLIPLHNAASYGHVDIAALLIKHNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADP
TMRNQEGQTPLDLATADDIRALLIDAMPPDALPSCLKPQATVVSASTGATGGVVISPSPS
PSCLSAASSIDNLTTPLGDLTVGGATGSVDVTSVSDRKEGEALLDTTISHFLRSLGLEHL
RDIFQREQVISLLDVLADMGHEELKEIGINAYGHRHKLIKGIERLLGGQQGGNPYLTFHC
SGQGTVLIDLAADDKEFQSVEEELQSTIREHRDGGNAGGVFSRYNIIKIQKVVNKKLRER
YAHRQKEIADENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKS
NQYVYGIGGGTGCPAHKDRSCYVCHRQMLFCRVTLGKSFLQFSAMKMAHAPPGHHSVIGR
PSVNGLAYAEYVIYRGEQAYPEYLITYQIVKPESPAAPAAASEQKS
Download sequence
Identical sequences H3D6S3
ENSTNIP00000016214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]