SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016217 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016217
Domain Number 1 Region: 4-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016217   Gene: ENSTNIG00000013234   Transcript: ENSTNIT00000016429
Sequence length 114
Comment pep:novel chromosome:TETRAODON8:4:791793:792688:1 gene:ENSTNIG00000013234 transcript:ENSTNIT00000016429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLPSCPTGEESCSDGSRCIYSGRFCDGRLDCPDQSDELDCAETTCLPSALNQQLNHDSGF
NRNVWSSIRSRSTDKETLMVNIQLPPEHSDSDTEEELESPVDVKSRAIAAAQLK
Download sequence
Identical sequences H3D6S6
99883.ENSTNIP00000016217 ENSTNIP00000016217 ENSTNIP00000016217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]