SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016250 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016250
Domain Number 1 Region: 715-947
Classification Level Classification E-value
Superfamily vWA-like 4.45e-51
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1-187
Classification Level Classification E-value
Superfamily vWA-like 2.74e-30
Family Integrin A (or I) domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1050-1105
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016250   Gene: ENSTNIG00000013265   Transcript: ENSTNIT00000016462
Sequence length 1107
Comment pep:known_by_projection chromosome:TETRAODON8:3:3079211:3092881:-1 gene:ENSTNIG00000013265 transcript:ENSTNIT00000016462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSLELAFLIDSSESAKDNHAQEKRFATDVMDRLRGLRLQTGRGFTSRAALLQYSSHVIIE
QTFNQWRGADDFKARVAPMVYIGHGTYTTYAITNLTRIYLEESPLGSIKVAFLLFDGISH
PRNPDIFSAVADAKNQGVQFFAIGITPEAKEPGNIAQLRLIASSPASRYLHNLQDKGIVE
KVINEIVIFWSLKCPLAQTKCGCEKGEKGSIGAPGKKGRAGEDGSPGLRGQKGEVGVSGL
PGREGAEGKSGYKGEKGERGECGTPGIKGDRGPEPVGPRGNRGFQGLPGPPGEIGPEGVI
GKKGERGLPGPPGIQGETGIGLPGPKGDAGIQGQLGPPGPQGFGEPGPPGPQGPQGVQGE
RGQMGEGLPGPKGERGLEGPRGPRGQPGIGIKGDKGDFGPPGFPGPTGLPGAGIQGEKGT
VGPRGAPGSRGPPGEGLPGPKGDQGLPGEIGAPGERGAGDPGPKGDPGATGMSGLPGLPG
EDGAPGQKGETGAPGPRGLEGVPGIGIQGEKGDQGQRGIRGLTGPIGVTGTSGPKGEPGA
PGRVGSPGPPGRFIAGPKGDIGPTGLPGPVGETGYGLPGPKGDRGEPGPAGPAGPKGDGF
LGPTGPPGPPGLPGESGLEGVGLPGPKGDVGSRGLPGLPGPPGEGLQGPLGNTGRPGPPG
PVGPPGKGLQGPKGERGPQGVSGPRGLPGEGFPGAKGDRGLAGERGTKGLKGDMGDPGSP
GQPGRPGVKGEAGITREDIIRMIKEICGCGIKCKERPMELVFVIDSSESVGPENYEIIKD
FVNALVDRVTVGRNATRIGLVLYSLEVNLVFNLARYSNQQDIKQAIRNIPYMGEGTYTGT
AIRKATQEAFHGSRLGVSKVAIVITDGQTDKREPVKLDIAVREAHAANIEIFALGIVNTS
DTTQAEFMRELNLIASDPDEEHMFLIDDFNTLPVSALESKLVSQFCEDENGALIYNRVTN
GYNGYGNGHNSNTGNRNGNYAVGGYGYQISINRGQTETTQHGSQTHAAIMGSVCHRWQVS
TTWQLQKILQFQEVKLNNVLHLSPPEPAPADPRCGLPLDQGTCRDYNVRWYYDKQANACA
QFWYGGCDGNKNRFDTEEECQRTCLIR
Download sequence
Identical sequences H3D6V9
ENSTNIP00000016250 ENSTNIP00000016250 99883.ENSTNIP00000016250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]