SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016252 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016252
Domain Number 1 Region: 530-711
Classification Level Classification E-value
Superfamily vWA-like 7.37e-44
Family Integrin A (or I) domain 0.00046
Further Details:      
 
Domain Number 2 Region: 2-190
Classification Level Classification E-value
Superfamily vWA-like 1.68e-31
Family Integrin A (or I) domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016252   Gene: ENSTNIG00000013265   Transcript: ENSTNIT00000016464
Sequence length 711
Comment pep:known_by_projection chromosome:TETRAODON8:3:3080971:3092887:-1 gene:ENSTNIG00000013265 transcript:ENSTNIT00000016464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDCSLELAFLIDSSESAKDNHAQEKRFATDVMDRLRGLRLQTGRGFTSRAALLQYSSHVI
IEQTFNQWRGADDFKARVAPMVYIGHGTYTTYAITNLTRIYLEESPLGSIKVAFLLFDGI
SHPRNPDIFSAVADAKNQGVQFFAIGITPEAKEPGNIAQLRLIASSPASRYLHNLQDKGI
VEKVINEIVTICENVVFPFCCSMIWIKPRASNNQPLQGKKGRAGEDGSPGLRGQKGEVGV
SGLPGREGAEGKSGYKGEKGLPGPPGEIGPEGVIGKKGERGLPGPPGIQGETGIGLPGPK
GDAGIQGQLGPPGPQGPQGPQGVQGERGQMGEGLPGPKGDQGLPGEIGAPGERGAGDPGP
KGDPGATGMSGLPGLPGEDGAPGQKGETGAPGPRGLEGVPGIGIQGEKGDIGPTGLPGPV
GETGYGLPGPKGDRGEPGPAGPAGPKGDGFLGPTGPPGPPGLPGESGLEGVGLPGPKGNT
GRPGPPGPVGPPGKGLQGPKGERGPQGVSGPRGLPGEGFPGAKGDRGLAGERGTKGLKGD
MGDPGSPGQPREDIIRMIKEICGCGIKCKERPMELVFVIDSSESVGPENYEIIKDFVNAL
VDRVTVGRNATRIGLVLYSLEVNLVFNLARYSNQQDIKQAIRNIPYMGEGTYTGTAIRKA
TQEAFHGSRLGVSKVAIVITDGQTDKREPVKLDIAVREAHAANIEIFALGI
Download sequence
Identical sequences H3D6W1
ENSTNIP00000016252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]