SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016282 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016282
Domain Number 1 Region: 2152-2222,2409-2691
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.36e-67
Family Hect, E3 ligase catalytic domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2272-2356
Classification Level Classification E-value
Superfamily PABC (PABP) domain 1.83e-23
Family PABC (PABP) domain 0.0000492
Further Details:      
 
Domain Number 3 Region: 326-461
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000000000746
Family Regulator of chromosome condensation RCC1 0.035
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016282
Domain Number - Region: 155-191
Classification Level Classification E-value
Superfamily UBA-like 0.0935
Family UBA domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016282   Gene: ENSTNIG00000013292   Transcript: ENSTNIT00000016494
Sequence length 2698
Comment pep:known_by_projection chromosome:TETRAODON8:8:9849442:9869087:1 gene:ENSTNIG00000013292 transcript:ENSTNIT00000016494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKYSYNSHPHLGLLEQATLKQCVVGPNHAGFLLEDGRVCRISFAVQPDRLELSKPDGSDG
SKLSSGSGTGRSSRPGRTSDPPWFLSGSDTLGRLAGNTLGSRWSSGVTSGRSSTAARDSR
RQTRVIRTGRDRGSGLLGSQPQPVIPASVIPEELITQAQVVLQGKSRSVIIRELQRTNLD
VNLAVNNLLSRDDEDGDDGDDTASESYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDI
SYFGYPSFRRSSLSRLGPSRVLLLPLERDSELLRERESVLRLRERRWLDGASFDTERGST
SREGEANLDKKSIPVQSPVSLGEELQWWPDKDGVKFISIGAMFSELVAVSSKGELYQWKW
SEPEPFRNAQNPSIHHPRVPFLGLANEKITLMSANSIRATVATETNKVATWVDETLSSMA
SKLEHSAQAFPELQGERMVSLHCCAFYTCAQLDNGLYWWGVVPFSQRKKMLEKARAKNKK
PKSSAGMSSIPNITVGTQVCLRNNPLYHAGAVAFSVSAGIPKVGVLLESVWNMNDSCRFQ
LRSPESLKTMEKTTKTQEIKTESKPELVKTEMGPPPSPASTCSDTSSIASSASLPYKRRR
STPAPKEEEKVNEEQWPLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSSMSSQSSA
APADSDPSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKAEILAVNVDSK
GVHAVLKTGNWVRYCIFDLATGKAEQENNFPTSNLAFLGQSERNVAIFTAGQESPIILRD
GNGTIYPMVKDCVGGIRDDWLDLPPINSLGMGVHSLANLPSNSTIKKKAAIIIMAVEKQT
LMQHVLRCDYEACRQYLNLEQAFMLDQGSQALGALLDHRCDGNRNILHAAVSVCFPVSNK
ETKEEEEAERSERNTFAERLSAVEAIANAISVVSSNSSGNRTGSSSSRGLRLREMMRRSL
RAAGVGRHESGPSSSDHQDPVSPPIAPPSWVPDPPPMDPVSDGDIDFILAPAVGSLTTAS
TGTSQGPSTSTIPAGPSNESPVVESKDRKANAHLILKLMCDSVVLRPHLRELLSAKDARG
MTPFMLAVSGRAYPAAITVLEAAQKMAKEVGDPGITEKEDADSVFMEMICPSGTNPDDSP
LYVLCCNDTCSFTWTGAEHINQDIFECRTCGLLDSLCCCTCARVCHKGHDCKLKRTSPTA
YCDCWEKCKCKTLIAGQKAARLDLLYRLLTTTNLVTTPNSRGEHILLFLVQTVARQSVEH
CQYRPPRIREDRNRKAANTEDSDMPDHDLEPPRFAQLALERVLQDWNALKSMIMFGSEEN
KDPLSASSRIAHLLPEEQVYLNQQSGTIRLDCFTHCLIVKCAPDITFIDTLLSTLVRELQ
NKYTPGRREEAVNVTRRFLRSVARVFVILSVEMASSKKKNNFIPQPIGKCRRVFQALLLW
RSCVAESLIVPVRMGIARPTAPFTLASTSIDAVQGSEELFSVEPLPPRPSPDQSSSSSQT
AASYIIRNPQPRHSSQSQPVRGRDEEQDDIVSADVEEVEVVEGVAGEEDHHDDQEEQGEE
NPETEGQHDEHDEDGSDMELDLLAAAETESDSESNHSNQDNASGRRSVVTAATAGSEAGA
SSVPAFFSEDDSQSNDSSDSDSSSSQSDDVDQETFLLDEPLERTTSASHANSAAQAPRSM
QWAVRNTPSQRASGSAPSNSSTPSASSTGLIYIDPTNLRRSSAISSSAAAAAAALEASNS
SSYLTSASSLARAYSIVIRRVSGCGVIPKYNHLVYSQYPAAVKLTYHDAVNLQNYVEEKL
IPTWNWMVSIMDSTEAQLRYGSALSSAGDPGHPSHPLHASQHSARRERINAREEASLRTL
EGRRRAATLLTARQGMMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQAL
IYWIKAMNQQTTLDTPQMDRKRNREILELGLDNEDSEHENDEDTNQSSTLQDKDEDPVPA
ETGQNHPFFRRSDSMTFLGCIPPNPFDVPLPEAIPLADQPHLLQPNARKEDLFGRPSQGL
YSSSFMANKGLAEASVDRNCLEILPTKMSYSANLKNVMSMETGQRNAGNQSIADQEMDTS
ITGALGARLHERMLEILTELGGFEVKESKFRREMEKLRNLQSRDLALEVDRDRDQLIQQT
MRQLNAHFGRRCTTTPMAVHRVKVTFKDEPGEGSGVARSFYTAIALALLSNDKLPNLDCV
QSVSKGMQASNLMQRLRNRDRERERRSGGLRAGSRRDRDRDSRRQLSIDTRPFRPSSEGN
PSDEPDPLPAHRQALGERLYPRVHAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARV
EEAMDLLIAHGRENGADSILELGLLEAPEKAQQQENRKRHGSTRSVVDMELDDPDDGEDN
APLFYQPGKRGFYSPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGR
KVNWHDFAFFDPVMYESLRQLIRHSQAGEADAVFAAMDLAFAIDLCKEEGAGQVELLSGG
VNMPVTPLNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNALEDLTAEDFRLLVNG
CGEVNVQMLISFTSFNDESGENADKLLQFKRWFWSIVEKMSMTERQDLVYFWTSSPSLPA
SEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV
Download sequence
Identical sequences H3D6Z1
ENSTNIP00000016282 99883.ENSTNIP00000016282 ENSTNIP00000016282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]