SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016285 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016285
Domain Number 1 Region: 319-543
Classification Level Classification E-value
Superfamily vWA-like 1.78e-62
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 3-191
Classification Level Classification E-value
Superfamily vWA-like 1.44e-55
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 3 Region: 189-314
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 547-587
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000288
Family Chicken cartilage matrix protein 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016285   Gene: ENSTNIG00000013295   Transcript: ENSTNIT00000016497
Sequence length 590
Comment pep:known_by_projection chromosome:TETRAODON8:8:9881083:9884499:1 gene:ENSTNIG00000013295 transcript:ENSTNIT00000016497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNPCKAVPLDFVFVIDSSRSIRPRDYEKVKTFIVNLVQFLEVGPEATRVGLLQYGSVVQP
EFSLSTFSTKAEVEQAVRNMKHLATGTMTGLAIQYAAETSFTEADGARPAHLHIPRIAVV
VTDGRPQDRVEEVAAQARQAGIQIFAIGVGRVDMKTLKTIGSEPHSEHVHLVASFSQMET
LVSVFQSKLCRGSEMCELLEHQCQHICVSSPASFRCKCREGFTLNPDGKTCKAEDACATA
DHGCHHFCANLAEGYECRCRPGYRLKPDLRTCSKIDFCDLGDHGCQHDCFSTPESYTCGC
RRGYRLNPDGKTCTSLDVCQTLEHGCQHQCISAADSYVCRCSEGFVLEEDGKRCKRSACA
DGAMDLVFMIDGSKSMGPANFERVKQFVISIVESLDVSPTGAHVGLLQYSTNVRTEFTLS
QHTSAQGIRQAVSRMQYMGRGSMTGSALRRMFQSSFSAEEGARPNVPRVSVVFTDGRSQD
DASEWAKKAKNSGVTIYAVGVGKAIEQELREIASEPEEKHLYYAQEFKDVGEITEKLKSR
MCTDKPSDENRCRCENMIIFQNQVTDWQLSLTRTLEAMSTRLQALENTSA
Download sequence
Identical sequences H3D6Z4
ENSTNIP00000016285 99883.ENSTNIP00000016285 ENSTNIP00000016285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]