SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016350 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016350
Domain Number 1 Region: 34-229
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000276
Further Details:      
 
Domain Number 2 Region: 459-671
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.97e-60
Family Ankyrin repeat 0.0000235
Further Details:      
 
Domain Number 3 Region: 225-351
Classification Level Classification E-value
Superfamily E set domains 4.43e-43
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000051
Further Details:      
 
Domain Number 4 Region: 738-815
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000016
Family DEATH domain, DD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016350   Gene: ENSTNIG00000013359   Transcript: ENSTNIT00000016563
Sequence length 848
Comment pep:known_by_projection chromosome:TETRAODON8:17:7774056:7778413:1 gene:ENSTNIG00000013359 transcript:ENSTNIT00000016563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDPRLQLQMNLMQYDYIPRVDIKTEPYIPETAHGPYIQIIEEPKQRGFRFRYECEGPSHG
GLPGASSEKNRRTYPTVKINNYVGHARVEVQLVTHTDPPRVHAHSLVGRHCTENGTCTVD
VGPNDLTASFSNLGILHVTKKSVVEVLTRRLREERRRQKGAHCHLTDSEENSILKEAKEL
GKVMDLNIVRLKFTAFLQDSNGGFTRALKPVVSNAIYDSKSPNASNLKISRMDKTCGTVL
GGDEIFLLCDKVQKDDIEIRFYEEDEGGWEAFGDFSPTDVHKQYAIVFKTPPYHSAEIER
PVTVFLQLKRKKAGDSSDPKQFTYIPHVQDKEEVLRKKQKPLPHYEPWFGGGGGAVTIVW
CLSGYQFNSADDEASPVLTEGAGTQMSGSAPRPQRGGHTRGPNVAAPLQRLHRIATALHH
STSQRAQQTAAGLLQYCSSGDTRVLLAVHTHLCSVQDTNGDTPLHLAVIHQQTAVVHQLV
QTLLSSRQPGVLNTANHLLQTPLHLAVITRQVKVVELLLRAGVDPSLPDKDGRTPVHLAA
SAGDSATLRLLLAHLGESHAHVVNSPDYHGLRPLHLAVRRDGERCLRLLVEGGAKINAPE
QKSGHTALHQAVKENLFKVACTLITELKADVNACTFGGNTPLHLAASQGSPTLCSMLVAA
GADKNVENDEPLLLSSSSDEEEPEGDAPEASQPITRKRPAGGHTPLDLASCQKVRNLLSS
GTRPSPVHSGSPGAESASLDEDTVSRLMDVLSDTDVPWMKLAEKLGMKTLTQLYVDTEAP
CQHLLQHYKLAGGPVQVLIEALQDLGLSEGVRLLRTTERQQEKHNTVQSEATVDSGFSSQ
PMEEEEQE
Download sequence
Identical sequences H3D759
ENSTNIP00000016350 99883.ENSTNIP00000016350 ENSTNIP00000016350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]