SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016402 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016402
Domain Number 1 Region: 68-204
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-23
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 372-412
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000235
Family SOCS box-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016402   Gene: ENSTNIG00000013408   Transcript: ENSTNIT00000016615
Sequence length 433
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:31441336:31443882:1 gene:ENSTNIG00000013408 transcript:ENSTNIT00000016615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLHGFRRIIYEYQPLVDNIMCVIGMEEEDHDGRVRSPEEESAVCAALAELLEREGPSE
VFLEGISYALFKVAERGLLGAAQVLLRYGADLNFEDPVSYYNPLHIAVLRNRPSMVRLLV
SHGADVEKRDRIHESSPLDLASEESERLPCLLTLLDMGARVNAEDKHRKTPLLHALASSD
GLTVHNTENIRLLLQRGADREHATSASSGTVESSLVFLVKEALEASAEDAAQIGSFCLET
TRLLMAHGVDPSCCLNDGEPSLTQTSLEHFDLLFPLAVLLIQSGASLVCSLHGGSCWSAH
SLLFQRLQAALQRSPDQSRASELIEQAEVLLDLARVDSPLLHPPPRLPLSAPDQPHAQAL
ADMHSRMLAADSSPPSLRRLCRAFLRAQLRPWPLQDRVGSLPLPDRLKKFLLPERMYAPK
PGWDRFKPQHNHS
Download sequence
Identical sequences H3D7B1
99883.ENSTNIP00000016402 ENSTNIP00000016402 ENSTNIP00000016402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]