SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016405 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016405
Domain Number 1 Region: 19-221
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.05e-45
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 316-372
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 1221-1327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000183
Family Spermadhesin, CUB domain 0.012
Further Details:      
 
Domain Number 4 Region: 1001-1056
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 746-803
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000929
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 
Domain Number 7 Region: 942-998
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000955
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 8 Region: 821-879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000876
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 
Domain Number 9 Region: 888-938
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000366
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016405
Domain Number - Region: 635-683
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000196
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number - Region: 1112-1211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000236
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016405   Gene: ENSTNIG00000013411   Transcript: ENSTNIT00000016618
Sequence length 1329
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:31470879:31480742:-1 gene:ENSTNIG00000013411 transcript:ENSTNIT00000016618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPFTGRGRLPRSVLMPDVSHLELLVVVGPDVQQVHKQDTERYILTNLNIASELLRDMTLG
ANMRVHLVHMVALSEPDPEIQLSANITSSLRSVCEWGRKINPSNDSDPLHADLLLYITRY
DLVLPDGNKQVRGVAQLGGACSSEWSCVIAEDTGFDLGITIAHEIGHSFGINHDGVRNTC
SKSGFIMASDGGYNSVDLTWSPCSRQQLLAFFSDGRAECVKDLPALGGSMQDWKPGLYYG
VDDQCRIAFGSSARACSFSNADLPTCRTLSCHVNPHDDSSCKRLLVPLLDGTECAPHGWC
LKGRCVLMDELSSSVVVHGSWSSWSQFSPCSRTCGGGITHRTRKCTNPRPAFGGKDCEGT
DVEAELCHQQRCENRTQLDFIAEQCSKTDAQALYLLPKSASFYTWIPAVGFTQGEEQCRY
LCQSDGENFLVSRGSQFVDGTRCESDSPPPFGSIAACLRGTCQLFGCDGTLRSGRARDVC
GVCEGNGSSCSLISGSYTAGQARAYTTFLSVPVNATQVHIINRAPLFTHMAVLLGSQYVV
SGRGTMALNVTYPSVLDEDRLEYRLYLTPDLLPEMEELLMPGPLHEEVHVQVYRKYGKEY
GEKTNPNISYQFYVPGSSKDVTNSRPKGRWAFVTTPCSVSCGSGVQTHVRVCTDENTKKH
LEDDSCEAPPVTPPPTPCQRPPCPPRWDTGPFGPCSTSCGGGEHERLVRCVQTLGRAEVQ
VPNSECPAETAPHSVEKCNLQHCPARWQVSEPGECSAICGPGEAKRVVSCVRPENGQYVK
VDEVFCQKQSRPEDSVPCVVDVCPIGWESKSGLLTDPKQDPVYVWSPVVSKCSKTCGNGT
LQLWFSCVDHQTRLGVADFYCDASTKPPLQSESCNASPCPPTWRFKQGVCSVTCGGGLAN
RVLYCGREAEGEEEVLENSECSHSAKPTAVVSCNSHSCPARWKVRRTSPCSVSCDLGIAQ
RTVSCVQFVNGTESAVAEANCHSVVRPATTVPCLVQVCTFRWEVQEWSQCSVSCGYGIQS
RVVSCMGPSQPQPLSPLLCMHMPKPITIQSCSVGNCRDASLRPTYRSGPPGPTKASASLQ
NIPTSIPSAKTSQHTDLRIPQFFSDSSQRCVSPDACGRLLLEPSGTVDLSGVNGQCTVFI
GRPLDEVIYVKIESGSLDCKLQKEYVLFFDRLALVRKCKQLTGAELTTRTNVLLVRQRLL
TPGNGVTFTYTSQKNTKRSHHWDCDVQLFSPSGVFENPTTSHSNHSCRVLINAPPSVKIQ
VQALHVGFNSTSSRSTYIMIRDMDMLKTTVFKGHQLFLWRSSGNMAEVEFHGEYLRSKGS
FRAEYSFVS
Download sequence
Identical sequences H3D7B4
ENSTNIP00000016405 ENSTNIP00000016405 99883.ENSTNIP00000016405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]