SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016407 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016407
Domain Number 1 Region: 702-793
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 608-698
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-21
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 518-613
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-20
Family I set domains 0.06
Further Details:      
 
Domain Number 4 Region: 796-891
Classification Level Classification E-value
Superfamily Immunoglobulin 5.76e-19
Family I set domains 0.0058
Further Details:      
 
Domain Number 5 Region: 39-214
Classification Level Classification E-value
Superfamily vWA-like 1.21e-17
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 6 Region: 884-982
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 445-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000443
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 995-1027
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000631
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016407   Gene: ENSTNIG00000013413   Transcript: ENSTNIT00000016620
Sequence length 1031
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:31500707:31520894:1 gene:ENSTNIG00000013413 transcript:ENSTNIT00000016620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCDLFKWLVLAFCISQQGLFAVARPDVEDESDDSASTLAFVFDVTGSMYDDLKQVIDGA
SRILEKTLSRRTRPIKNFVLVPFHDPDIGPVSITTDPEKFQQDLQELFVQGGGDCPEMSV
GAIKKALEVSLPGSFIYVFTDARAKDYRLKRDVLQLVQLRQSQVVFVLTGDCGDRSQPGY
RAYEEIAATSSGQIFHLDKQQVNEVLKWVEETVQAMKVHLLSSNHDGAQENKWDVPFDPS
LREVTVSLSGPAPQIELSDPFGRVVGEAQGLTELLNIPNSARVVNLKFPRPGTWKLKVSC
SGRHTLRVTGVSNLDFRAGFSSVPVSEFNHTRERPIKGLPTHVMLKCTGLKPPGELNLAE
LMSSSGRSLRTIPVPPPSGVHQHRLWRLPEFRTPSQSFFIRVTGKDDEGYRFQRLSSVSY
TNVIPGKTAPFPQIIQSGPRCFYMQPVVIRCSVGSPIPYKLRFTRDGITVGEEKLYQSSA
LASWEIDHASAEDEGLYECIAQSKAGQGRALTQLTVREPPPVLKPPVNVTSSVGAVAVLS
CKVEGSMRHNLTWYRAGRAIQAPTGGFKVLPDSSLQIIGVRTQDAGEYHCVATNAHGDSR
IAVWLHVPEAPRIKVTQQDIHVSVGADAVLECQATGAPPPLVRWFKGEFEVGSTLFAGQD
DYHGTLHIRGVQKVDAGQYTCVASSPAGTATGTVSLKVGEDPLFSETPADLMAKIGENVT
LRCSARGSPQPTVSWHRHDGRQILTGSRSRMVQLEDGHLLIQGVWLSDEGLYVCEAKNPF
GTIKTGARLSVTGLAPPLLAQGPAVISTGIGQPLSIPCMMLDGIPLPERYWSHNGKPVDA
NGRAFLRSDGSLSVEKAVAEDAGTYVCTAVNIAGSKNVTVSVEIHVPPEIHAGPYHYIAN
EGVSITLFCKSSGVPKPDVVWSKVQCSLSLGTMLPVSVHQMATFHIPHPTTDDAGIYVCT
STNPVGYASREIQLSVNTMPKITGVTSNNKTVKMAAEVGTQVVLPCEAQGNPSPLVTWRR
NGHPIPPVTAG
Download sequence
Identical sequences H3D7B6
99883.ENSTNIP00000016407 ENSTNIP00000016407 ENSTNIP00000016407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]