SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016408 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016408
Domain Number 1 Region: 120-335
Classification Level Classification E-value
Superfamily GFP-like 9.73e-61
Family Domain G2 of nidogen-1 0.0053
Further Details:      
 
Domain Number 2 Region: 27-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-21
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 441-526,569-621
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.46e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 337-454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 617-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016408
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000497
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016408   Gene: ENSTNIG00000013414   Transcript: ENSTNIT00000016621
Sequence length 791
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:31539165:31548177:1 gene:ENSTNIG00000013414 transcript:ENSTNIT00000016621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGDAGMYQCLAKNEAGVAVGRTRLVLQVPPVLSVPRMEYTSVLGQPVSLECVADGQPPPE
VAWLKERRPVIEGAHIRIFANGTLAIASTQRSDAGLYTCTAKNLAGRASHDMRLAIQGES
PRKTRGSLIGMVNEREFGVSSLEATISDSEEEDGSNLLQARLDNIPPSVGPLMRALVSVF
APIYWTTVLQRGAARNGYSFTHGQFRQESQLEFDTGEILRVTHVARGLDSEGVLLLDIVI
NGFVPPSLASSLLSLQGFNESYMQTGQGQFYSWSSQTHRRGGAPMVLRCNHTIIYEGQEE
RQGPLLQLLRLSEIDSVYNMLTLSLEFHITASLHVADGYEDSCPEGFTLDQTYCAELDED
ECALRSPCSHSCNNIMGGFSCSCPSGFTISTVSNTCQDVDECSQGLHMCHYKQQCVNTAG
AYRCQAKCGAGFKPSVTGTGCEDIDECHDGSHMCRYTQICQNTVGGYGCICPRGYRSQGI
GFPCLDIDECQQTPNPCAHQCRNVPGSFRCLCPPGTMLLGDGRSCAGLERGPIFSNGTRV
RARLRPQLVSSLGRPILSRSSGASRITRQSCPIGYTSRDGACVDVDECQLRRPCQHECRN
TVGSFHCLCPPGYQLLPNGRNCKDIDECVEQGVQCGHNQMCFNTRGGYQCMDTPCPASYQ
RGGSPGTCYRACYRDCPAGGSTLLLQYKLLTLPSGIPAHHNVVRLSAFSESGVLQDRTSF
VILEQESESGVPGRVFGIRDEAGRGIIFTVQALDRPGLVRLKVQATTISPQGRITYQSIF
IIYISISAYPY
Download sequence
Identical sequences H3D7B7
99883.ENSTNIP00000016408 ENSTNIP00000016408 ENSTNIP00000000367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]