SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016437 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016437
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.41e-83
Family FCH domain 0.000000000938
Further Details:      
 
Domain Number 2 Region: 553-610
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000236
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016437   Gene: ENSTNIG00000013442   Transcript: ENSTNIT00000016650
Sequence length 618
Comment pep:known_by_projection chromosome:TETRAODON8:4:5663962:5685050:-1 gene:ENSTNIG00000013442 transcript:ENSTNIT00000016650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIFSPILQDQFDNLEKHTQWGIEYLEKYTKFVKERSEIELNYAKQIRNLSKKYQPKKNSR
EEEESKYTFCRAFLATLNELNDYAGQHEVIAENLVSQIITELVRYTQDLKAERKSHFHDG
RKAQQHIESSWKQLESCKKKFERDCKEADRANQYFEKLDADINVTKADVEKARQQAQMRQ
QMAADSKNDYSSYLQKFNQEQNEHYFTNIPAIFQKLQDMEEKRIEKLGVCMKTFAEVDRQ
VLPIVGKCLDGMTKAAESIEPKTDSKQVVESYKSGFEPPGDVEFEDYGQAMKRTASETSL
SNSKDGKEKSGSKSKGKLWPFIKNKNKINVLIVVPCEGPPALSASSLPSPSAVPNDSQSP
KQHKEPLSNRLNDFMASKPKMHCLRSLRRGGSGPEDFSHLPPEQRRKKLQGKLDDINKDI
QKEMDQRDALTKMKDVYIKNPQMGDPASVDPRLSEIGQNIEKLQFEAQKFEGWLAEVEER
MPSKSDTHRRSVLYEAQNSTTVGNNCAQDRESPDGSYTEEQNSETQVKAIVNPTSTTPDF
DDEFDDEESLPTIGTCKALYPFEGHNEGTIAMAEGELLYVIEEDKGDGWTRVRRNQDEEG
YVPTSYVEVFLETNAKGA
Download sequence
Identical sequences H3D7E6
ENSTNIP00000016437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]