SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016438 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016438
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-40
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016438   Gene: ENSTNIG00000013443   Transcript: ENSTNIT00000016651
Sequence length 1730
Comment pep:known_by_projection chromosome:TETRAODON8:4:5585089:5622271:-1 gene:ENSTNIG00000013443 transcript:ENSTNIT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEPADLLKILDFHNLPEGVTRTTGFCSHRRSAQGADVAYRVSKNAQLSAPTKQMYPGDA
FPEDFSILALVKPKKGSQSFLLSVYNEQGIQQLGLEVGRSPVFLYEDHTGRPSPEDYPLF
RGVNLADGKWHRVAISVHKQTVTLILDCKKKTTQKLLRSPSPIIDTKGIVVFGTRILDEE
VFEGDIQQLMIVSDHRAAYDYCEHYSPDCDVPAPEQPQNQDPNTDEYNPDGNYYYEYPYY
DDGDDKPKPSHTGINLTSYTGEVTSTSTRASSGGTGSSSSSSSSTATGEETSLNGNDYDY
NYNYESYDDTTALPDEDTSRRVTISTDSGAELDLELKEKTDPAPGTGMHFSTSDLGTSVT
INQNKTELFDGARGEKGQKGEPAVIEPGMLVEGPPGPEGPTGLPGPPGSSGPPGTPGDPG
ERGPPGRPGLPGADGLPGPPGTVLMLPVRFASFAPNCLHRCETCGQQSRLAEPSEHFVKG
LMMHSNITAGIIKGVKKDHAALWDPPGPTGKPGRRGRPGADGARGMPGQSGPKGDRGFDG
LAGLPGEKGYRGESGPSGPPGAPGEDGERGDDGEIGPRGLPGEPGPRGLLGPKGPQGPPG
PPGVTGMDGPSGLKGSIGPQGEPGPPGQQGNPGAQGLPGPQGAIGPPGDKIPLHYPRGSI
PGCDGFTXPPMCCYKLQGPNKDLSPQGPPGPQGPIGYPGPRGVKGADGVRGLKGNKGEKG
EDGFPGFKGDMGIKGDRGELGAAGPRGEDGPEGPKGRLGPGEAGPLGPTGEKGKLGVPGL
PGYPGRQGPKGSQGFQGFPGANGEKGTRGTAGKPGPRGQRGPTGPRGERGPRGPTGKAGP
KGNSGNDGPPGPPGERGLPGAHGPTGFPGPKGPPGPPGKDGLPGHPGQRGETKTQGFQGK
TGPPGPPGVVGPQGPTGETGPMGDRGHPGPPGPPGEQGLPGAAGKEGAKGDPGPAGPAGK
DGPPGPRGFTGERGLPGPVGAHGLKGNEGPHGPPGPAGSPGERGPAGPAGPTGLPGRPGP
QGPPGPAGEKGGPGEKGPQGPAGRDGIQGPVGLPGPGGPPGPPGEDGDKGEIGEPGQKGS
KGDKGEHVRSPGPTGPQGTVGAPGPAGGPPGPVGLQGLPGPAGEKGETGDVGQMGPPGPP
GPRGPAGPPGADGPQGPPGGIGNPGAVGEKGDAGETGEPGPQGEVGPPGPRGERGEKGEA
GPAGAAGPPGPKGPAGDDGPKGSPGPIGIPGDPGPPGEPGPAGLDGPAGDKGDDGEAGQP
GSPGPTGESGPSGPPGKRGPHGPAGPEGRQGEKGAKGESGLEGPQGKTGPVGPQGSPGKP
GPEGLRGIPGPVGEQGLPGSPGPDGPPGPMGPSGLPGLKGDTGVKGEKGHPGLIGLIGPP
GEQGEKGDRGLPGPSGSAGPKGDTGIAGPSGPLGPVGPPGLPGPPGPKGAKGSSGQTGPK
GESGTPGPPGLPGPPGDIIHPHPIQSSMKGRTRRNIDASQMDDAAADANYKDYDDGMEEI
FGSLNSLKLEIEQMKHPLGTQSNPARTCKDLQLCHPDFPDGEYWIDPNQGCSRDSFKVYC
NFTAGGESCIFPDKKSEGSRVTSWAKESPGSWFSEFKRGKLINNLSYGDAEGNPIGVVQM
TFLRLLSAAGRQNMTYNCYQSVAWHDQDGDNYDKAIRFLGSNDEEMSYDNNPYIRALADG
CALKKGYEKTVLEINTPKVEQVPFVDIMFNDFGGSTQKFGFEVGPVCFIG
Download sequence
Identical sequences H3D7E7
ENSTNIP00000016438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]