SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016460 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016460
Domain Number 1 Region: 1958-2177
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.93e-82
Family Fibrinogen C-terminal domain-like 0.000003
Further Details:      
 
Domain Number 2 Region: 870-1033
Classification Level Classification E-value
Superfamily Fibronectin type III 4.28e-24
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 3 Region: 1786-1952
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-20
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 4 Region: 1695-1783
Classification Level Classification E-value
Superfamily Fibronectin type III 4.76e-19
Family Fibronectin type III 0.0000997
Further Details:      
 
Domain Number 5 Region: 687-865
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-18
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 6 Region: 1139-1227
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-16
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 7 Region: 594-682
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000011
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 1233-1393
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000194
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 9 Region: 1608-1694
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000441
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 10 Region: 1502-1603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000683
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 11 Region: 1058-1134
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000211
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 12 Region: 1418-1500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000261
Family Fibronectin type III 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016460
Domain Number - Region: 414-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00199
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 475-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 537-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00324
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 353-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00607
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 291-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 569-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00827
Family Integrin beta EGF-like domains 0.079
Further Details:      
 
Domain Number - Region: 383-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 322-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0199
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 229-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Integrin beta EGF-like domains 0.083
Further Details:      
 
Domain Number - Region: 198-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0283
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 507-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0408
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 260-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family Integrin beta EGF-like domains 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016460   Gene: ENSTNIG00000013465   Transcript: ENSTNIT00000016673
Sequence length 2186
Comment pep:known_by_projection chromosome:TETRAODON8:4:4833708:4845943:1 gene:ENSTNIG00000013465 transcript:ENSTNIT00000016673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKGLLGCLLLLALLSVSKAGLVGKILRHRRQTLAAPEEFNTSVPSAGQPVVFNHVYNI
NVPASSLCSVSLDSPDSALLEAQEGTGHQSTEHTVDGDNQIIFTHRINIPRQACGCSDDL
LGLRDLLSRLEMLEGEVSALKDQCNGERMCCGSQVTGEVAFTPYCNGHGNYSSETCSCTC
EPGWRGANCTELDCPGDCQGRGRCVNGTCQCLEGFGGENCTVEECPVGCGTNGRCVAGTC
VCSSGFFGGDCSQTECLNNCWRRGRCEGQVCVCDQPWTGADCSELLCPKDCLSRGRCENG
TCYCDEGYAGEDCGQRTCPGKCHGNGFCVDGRCVCIAGFSGEDCSQLNCLNDCNGRGSCF
NGLCICEAGYQGEDCSQLACLNNCNSRGQCINGQCSCDVGFYGEDCAELSCPNSCFNRGR
CVNGQCVCEEGYAGEDCRVATCPSNCYGRGKCSEGRCACHTGFTGECSKLSCPNSCQNRG
RCVNGQCVCNEGFAGEDCSRKACPNDCLARGHCHDGKCVCQDGYTGVDCSALSCPANCNH
RGRCVNGRCACESGFEGESCEERSCLNGCRGNGRCLSGQCLCDEGYVGEDCSGAVSPPTD
LVVSEVTSDTVDLLWRNQMLVTEYLVTYAPTRAGGLLQEFTVSGDKTAATVHELEPGLEY
IINVYAILSNKRSVPISARVATDFPRPEGVIFKSVSETSVEVRWDQLDIPFDGWEIFFRN
TFVSPQKEENGHIKTTVPSSQNQFVQSGLGPGQEYEIAINMVRNNTRGPQTTRTVTTKID
APQQVEVKDVTDTSALVSWSQPVASVHRITMFYGLISDPSDTNSVEIFPPDKQYSVDGLR
PDTEYKVTLISRRGDSTSDPVSTSFITALDAPTNLQITSQTDQSITVQWTNSKANVSSYL
VKYSPISGDGHGEELFPRQPGYSTKAALTGLRPGTEYGIGVTAVKNEAESLPATTNAETE
IDPPRNVEDVESSETSLTLRWQKPQAKISTYRLVYVSRDGQVEEELIPASATSYVMSNLT
PGMSYSVTLTAERGPRRSRPVSHSASTDAELTLGNLTFTSTIISLTWSAPDLEFESFLME
VRASSGVTHGHMTLPGKAREAEIVGLTPSTQYNITVQGLVEGRRSLPLNIFATTAEELQP
AVTNLTVSDRTWDGFTVSWTPAGGDFDSFVLEITNLENLEESQNLTLSGGALSLAVSGLN
PNTSYVVGLFGVYQDSVLEPVYTEATTVGLPAVGKLYITNLTSDSFSILWNSSHGEFDGF
VLEIIDSNWLMEPKEYNLSHLVRSYDITGLRPSTDYVAFLYGTYKSSRTSAVSTVASTAE
APDLSGLVVSNVTSDRFSLSWQTGEKHFDHFIIELRESTLPSQAMGRVVPGDGRSVVMSG
LKAGTSYDIKLYGSAGGQNTQALFDLTTTEDVPQLGLLTTSSVGPHDVSLTWATLSGHFD
AFVVRISDPEQQFDTQEYTLQRGARNFTVSDLVDATPYDFELYGISHDRRTPSVFAHAVT
APLPRVENMTVSQVTPHGFRVSWEVNQHLRQEDLAPSSGHFRHFHIVVTDSGWLLEPQEF
SVPGNQTHLDVTGLITGIGYEVRLTGVSESGLLSRPLTTVAVTVAEPEVEHLFVSDITDG
GFRLSWTSDEDMFDRFVVKIRDGKRLGHPREYAVRGDERTMVVTGLMSGAEYEIELYGVA
LDKRSQPVFGVAHTGLSTPKGLYFSDVTDSSAVVHWSTPRSAVDSYRVTYVPFEGGSPLT
VTVDGGVFEALLANMIPGRKYQVTVSSVKGLEESDPSMDTVTTALDRPRTLTALNVTDTS
ALLLWQPCAAAVDGYVVTYSAEAVPPVVEHVSGSTVEFEMGSLAPGTRYKVGVHAVKEAL
KSNPAITEFTTDVDPPRDLKAINIQTDGATLTWKPPQAAVTGYTLTFTAGGVIREVVLSP
TASSYTMAQLAGSTEYNIRLQAIAGAQRSRHVDAVFMTNGQLFARPRDCAQIRLNGEAVS
GLFSIYVGGEENQPLQVWCDMTTDGGGWMVFLRRQSGKLDFFRNWKNYTAGFGNMNDEFW
LGLSNLHKITSSGLYELRVDLRDSGESAFAQYDKFVVAEPRTRYKLYIGAYSGTAGDSMT
YHQGRPFSTYDNDNDIAVTNCALSYKGAFWYKNCHRVNLMGKYGDKSHSKGINWFHWRGH
EHSIEFAEMKLRPADFQRPESRRKRS
Download sequence
Identical sequences H3D7G9
ENSTNIP00000016460 ENSTNIP00000016460 99883.ENSTNIP00000016460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]