SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016480 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016480
Domain Number 1 Region: 154-377,421-471
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.4e-48
Family LacY-like proton/sugar symporter 0.063
Further Details:      
 
Domain Number 2 Region: 586-726
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.15e-20
Family Glycerol-3-phosphate transporter 0.02
Further Details:      
 
Domain Number 3 Region: 494-575
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000235
Family Pentapeptide repeats 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016480   Gene: ENSTNIG00000013485   Transcript: ENSTNIT00000016693
Sequence length 737
Comment pep:known_by_projection chromosome:TETRAODON8:4:4550538:4561962:1 gene:ENSTNIG00000013485 transcript:ENSTNIT00000016693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMDNNRTSLAKGAKDLAKEAKRQASKNFNKAVDRASDEYSAHRSYNRFHNEDEEEDNY
NSYNQQDRYDDDAANDEDGASSDATEGHDDEDEIYEGEYQGVPAYSDGKAQDGQVALGQP
VSDSLKSRKELENERQADEEELAQQYELIMQECGHGRFQWQLFFVLGLALMSDGVEVFVV
GFVLPSAEMDMCVPNSGAGWCAGSVVYLGMMLGAFYWGGLSDKVGRKQCLLISMTVNGFF
AFLSSFVQGYSMFILCRLVSGFGIGGAVPIVFSYFAEVLAREKRGEHLSWLCMFWMIGGI
YASAMAWAIIPHYAGWSFSMGSAYQFHSWRVFVVVCALPCVSAVVALTFMPESPRFYLEM
GKHDEAWMVLKNIHDTNMRARGEPERVFTVNRIKIPKQLDELVEMQNKSANIFVVAFFKT
WDEFRGIWSTFMKCFSPPMKDNTVKLAAVWFTLSFGFYGLSVWFPDVIKHLQADEYASRV
KIHNNERIEDFTFNFTLENQIHRNGLFLNDRFISMKFKAVTFIDSSFLNCYFEDVSSVGS
LFKNCTFVDSFFYNTDIDDFKLTDSRVINSSFHHNKTGCQMTFDDDYSAYWVYFVNFLGT
LAVLPGNIVSALLMDKIGRLSMLGGSMVLSGISCFFLWFGTSESMMIFMLCLYNGLSISA
WNSLDVVTTELYPTDRRGTGFGFCNALCKLAAVLGNLIFGSLVGITKAIPILLASTVLVV
GGLVGLRLPDTRANVLM
Download sequence
Identical sequences H3D7I9
ENSTNIP00000016480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]