SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016516 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016516
Domain Number 1 Region: 2276-2457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-33
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 2853-3021
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-32
Family Laminin G-like module 0.0000465
Further Details:      
 
Domain Number 3 Region: 2097-2272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.53e-26
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 2696-2839
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.46e-25
Family Laminin G-like module 0.0009
Further Details:      
 
Domain Number 5 Region: 2461-2646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-24
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 820-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 7 Region: 873-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 770-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 9 Region: 251-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 10 Region: 378-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 11 Region: 1380-1431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1437-1488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000787
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 13 Region: 709-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 14 Region: 1016-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 15 Region: 308-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 16 Region: 439-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016516
Domain Number - Region: 1486-1527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000257
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 966-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 922-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 1923-1943,1997-2081
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00256
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 674-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 59-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0238
Family APC10-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016516   Gene: ENSTNIG00000013519   Transcript: ENSTNIT00000016729
Sequence length 3049
Comment pep:known_by_projection chromosome:TETRAODON8:4:4143009:4193512:-1 gene:ENSTNIG00000013519 transcript:ENSTNIT00000016729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAILNLASNAVIDSNATCGDPGPEVYCKLVEHVPGRPVKNPHCARCDANSVLFRERH
PITNAIDGTNRWWQSPSIKNGRQFHWVTVTLDLKQVFQVAYVIIKAANSPRPGGNWILER
SLDGLTFDPWQYYAISDSECLSRYNVTPRLGPPTYKKDTEVICTSYYSRLNPLEHGEIHT
SLINGRPGADDLTSELLNFTSARYIRLRLQRIRTLNADLMTLSTRDPRDIDPIVTRRYYY
SIKDISVGGMCICYGHAQSCPLDLVTKKLQCVCEHNTCGESCNECCPGYHQQPWQPGTVS
EGNTCEKCNCHNKATDCFYNQTVAELSLSLDLHGLRRGGGVCVSCQQNTAGVNCESCVDG
YYRPAEVSPYSDFPCVACSCDPRGSESPVCSRGDTQPGQCVCKQGFTGRQCDTCAFGYRD
FPQCVRCECHSAGSTNADPCTPCTCKVNVMGANCDLCKPGFYNLQASNPLGCTDCFCFGV
SDVCESSAWSTAQVLHVDAWLLPHPAPPLTPVVHDNDLHTPGNTSSGHSYQEILLWEAPD
SFLGNKLGSYGGFLNYSLVYDVPLDNQDHSLPAHSDVIITGNGRALHSSPHFLFLSPLAE
SWVAMAIADRQLRDVETGDPVSRDELLLALANVTALTVRVGLNTSADGPIRLRLVSLDSA
DPSSASTQQAVAVETCECPWGYSGTSCEVCLSGFYRVGGVLFGGNCMQCECNDHATECDS
AGVCLLCSSGCAHNTSGPHCEECLPGFYGNATEGTADDCQPCPCPLTNPSNSFSPTCVLE
ASGQVSCDRCQEGYTGTTCERCASGFYGNPQVVGGTCVRCDCHGNVNVSEAGHCDVVTGE
CLRCLFNTGGPHCEVCQPGYYGDAVRAKNCQECGCDVVGAVSSVCDVTTGQCLCRENVTG
RACERCQSGFFGLRREQGCQGCGCNQSGSLSESCDEEGRCRCMTGVGGDKCDRCGHGYYG
ADISSCRACTCVHTGGNCDPQTGECTCPANTEGPTCGRCKAGYWGHNPTTGCEVPCSCSV
EGSSALECDLTNGQCQCREGFGGKSCDHCATGYHGYPACLPCGCDLAGTAQDMCHNAEYL
RVCEHGAVHQCVCFQVGVSGRRCEECVSGRFALSADHPDGCSPCFCSGVSGDCEEQGGLL
RVPLTLDPSPAPLSVVSQSNLRGVVSGVYQQGGDMLLDTRQLNTSGLAGPLYWRLPPQFE
GPQLLSYGGSLSYTITFYAEDGSGLSNQEPQVMIRGGTLKKMVIYTDMVAPSNGITTKHE
IRMTEHKWKYFNSVLETSVSHPDFMSVLGNIEYLIIKASYGSRLQQSRISNITMETAVEA
AEGSEVIGDLARSIESCICPTGYTGLSCQQGCAAGFFHQPLSELSSQRQRFLSVRPCVPC
RCSNHSERCDVESGECQDCQHHTSGESCQQCAPGYHGNVSGSISDCSLCACPLKDNSFSA
TCVSEGLLGDFRCTACQSGYQGRYCERCSTGFYGNPSVPGGVCLPCDCSGWGSRQPVCNN
LSGKCDCKAGVKGRSCDQCEDRHILQEGECVSCDDSCTGVLLNELEDVDHHLRTVNISSL
AVASYLQLAQLEKQSRQLQALVAGDAAASQQLSRLEEQLGSVSFNLSVLEQQVGSLNQME
EMRDASAQDSVYEGSRLLQNISILQDKIQALQKEAELLNETAEEELPSANQTRLLQQMEM
MLNSMRELNLTAASSLASQQLLLAKSVHSLQTDFLSSRAVVDDRLRPLSAALDRNSEMLR
HLREHLSNAAQQNQQTHKLQGGLHTLAQQYQRNLSEEHLLVAGSVEDGQLLLADTFSIQE
DLNNATAQVEVFSSHLDQWRPLLRKQVDGLVVGLKTTDALEKVYQSEKHSQQLQEEGHTL
HRSLEATKTAAAQSSIAHRSSVKQRSIVHIAALLATGPNQRAAHRWHLSSLTQLEEDSVY
EGSRLLQNISILQDKIQDMQLNVSMVTSRLVSFKDSLRNFSLLFRHPIRELQSLSNVSLS
ELQPAGLQPAAADPRLQGALQRLHSLEEQLQGSSSAVENTSNTARETNQLTAHTLATANQ
AQQKLGEVERRTERLMEQIKPLSVLGETLNRNLSEIRELIKQARRQAASIKVAVQADGKC
VRSYRPESESRNFNTLSLVLKTSSPDNLLFFQGSNTTRDFLALETHAGRVSLLWDLGSGS
TRLEFPGLDIANNRWTRINATRFGARASLWVHPLESDAEPLPAVMASSPGPARILDVDRN
SLLYIGGLGAHVQSPAALRSSTFRGCLGEASLNERNVGLWNYNSREGECGGCFSSPQAEE
TSFHFDGSGFSLVQKSLRATSTSIVLLFKTLSPGGLLLYLASNNTRDFLSIELVEGQVRL
TFDLGSGALVLTSSRKYNTGTWYKITLQRTKRKGYLSIMAADQPSEKEVLEAESPGTASD
LNRSDFDPIYIGGLPASRPIRRQVVSRSYVGCIKNVEIARSNFDLLRDAFGVRKGCVLEA
FRSVSLLTGGYVQIAPQPLGQEAELLFSFSTNNQSGILLAAFSPDHSQRRYFLSIHLASG
AVEAVIGEVGGAPQTVTVVKTNGGYFSDGVRHSVIVTINRKTLSIQVDEDNVKSIALLPG
RFSHLSPASFFIGGVPFGAESRLPARLQELSLSFRGCIQHLVLGGVLIDLSGALRYEGAE
LDSCLLKEKVRGAVLPDDQDAEPTVDPAHLPVVPPTQLTPGPLTCVSEAAPSFLPSAAQF
GLSKHSHMTFMINPSALRKSLSVRLSVRSRVPDGMILLLSDAKQMDFVVLKLTGGKLTLS
ADLGRGPASITSPVTVSDSQWHTVSAEVSRRSLSLAADASKPNSVSIKGNQLDVEKRLYL
GGLPHGHATRRINVGCLSSAACTPSPERRRAGSVQTTSRHNVTSCFTNDQAGSYFNGKLR
RLQVRDGYKVGSDVSVSLDFRTSQSEGVFLGISSAKIDAIGLEMINGQVVFNVNNGAGRV
TVASAGQLLCDGRWHHLLARKTKHSLSLKVDGRSYTTLNPYPQSTSAETKDPVYLGGYPV
GVKQNCLSIASRFRGCLKNAQLVKSHLNDALELGSAHSYSGITPHSCPV
Download sequence
Identical sequences H3D7M5
ENSTNIP00000016516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]