SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016517 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016517
Domain Number 1 Region: 178-320
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-40
Family Third domain of FERM 0.0000113
Further Details:      
 
Domain Number 2 Region: 74-179
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-35
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 4-73
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000558
Family First domain of FERM 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016517   Gene: ENSTNIG00000013521   Transcript: ENSTNIT00000016730
Sequence length 564
Comment pep:known_by_projection chromosome:TETRAODON8:4:4134589:4141631:1 gene:ENSTNIG00000013521 transcript:ENSTNIT00000016730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMVQAKVTLLDGSLFTCAVEKRALGFQLFEKVCEHVNLLETRLGTNWLDPVKEMKKQIRG
VPWNFSFSVKFYPPDPAQLSEDLTRYFLCLQLRQDVVSGRLPCSFVTHTVLGSYTVQSEL
GDYDPDDCGTDYASQLSFAPNQTKEMEEKIVELHKTYRGMTPAEAEMHFLENVKKLSMYG
VDLHHAKDSEGVAIMLGVCSSGLLVYRDRLRINRFSWPKILKISYKRNNFYIKIRPGEFD
QFESTIGFKLLNHRAAKRLWKVCVEHHSFFRLMSPEETPKKLLSLGSKFRYSGRTQIQSR
RASAQISRPPPRFPRCSSRRSMLSRSLDGASRAASSLIGSPVFTSSPKANGGSDMGAGLY
GALKFTTSDVITTVTPEKRTEEKGAELVKETAVSQQSPPSPHKQDTKDTAGSPEEEQQPQ
SSISVLRRSFFEGGVRPGTAETEWDKRLSSSPLRHLDSPMIEPLEPESGDGEEEGHVDSP
AGLLLSSQTFTAETSNTTTTTHITKTLKGTMSETRIEKRIVISGDTEIDHDQALAAALSE
ARRQHPELSVTRVVIHKETEVSPD
Download sequence
Identical sequences H3D7M6
99883.ENSTNIP00000016517 ENSTNIP00000016517 ENSTNIP00000016517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]