SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016527 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016527
Domain Number 1 Region: 1684-1767,1794-2051
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.85e-80
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000514
Further Details:      
 
Domain Number 2 Region: 1489-1671
Classification Level Classification E-value
Superfamily ARM repeat 6.25e-39
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.014
Further Details:      
 
Domain Number 3 Region: 16-46,85-166,315-376,514-740,878-965
Classification Level Classification E-value
Superfamily ARM repeat 0.00000309
Family MIF4G domain-like 0.091
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016527
Domain Number - Region: 791-877
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.00178
Family ADP-ribosylating toxins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016527   Gene: ENSTNIG00000013531   Transcript: ENSTNIT00000016740
Sequence length 2056
Comment pep:known_by_projection chromosome:TETRAODON8:4:4017770:4030153:-1 gene:ENSTNIG00000013531 transcript:ENSTNIT00000016740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPVDFRGVYQLDERRRDAVIALGIFLVESDLQHKDVIVPYLLGLLKGLPKVQWIEESSE
HKGREKLPVAENFTFSLVTLLSDVAQRDETLRGKILETIMDIMQVLQMICKNPEAQDKEY
LCRYIVPTLLGVARAFGRYSNTDEPLLSKLFPRPLAPVLPSADDTEAAQRSFNDFRSILP
SPLLTVCQGDTLRRKGPSLSSPSQQASPERACLTPSSPADPSAQYFEVLRLVPPGWQRVD
PDYYFSTISSSFSVSPLFTGSSSGEFHVPLDMLRQLLHMVEQFVSEQFLKSLDDGLGEVL
ELNPGLHLHYKTFSDPLYVAIFKMLRDTLYNLKDLQTDYVKEVHDFVLEQFSSSQSELQR
ILHDVEYLQSELSPLKLRCQANAACVDIMVWAVTEEQGAENLCTKLSEKLQSKTSSKVII
AHMPLLICCLQQGLGRLCERFPVVAHSVTMSLRDFLVVPSPVLVKLYKYHSQYTPGGSEI
KIHVTNEHSQSTLSAHSSKKSQPSMYEQLRDIAIDNICRCLKAGLTMDNVIVEAFLASLS
NRLYIYQENDKDAHLIPDHTIRALGHIAVALRDTPRVMEPILQILQQKFCQPPSQLDVLI
IDQLGCMVITGNQYIYQEVWNLFQQISVKASSMVYSTKDYKDHGYRHCSLAVINALGNIA
ANLQAEQMVDELLVNLLELFVQLGLEGKRASERASDKGPALKASSSAGNLGVLIPVIAVL
TKRLPPIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPAEWYEGVCEIATKSPLLTFPS
GEPLRSELQYNSALKNDTVTAAELNDLRSTIINLLDPPPEVAALVNKLDFAMSTYLLSVY
RLEYMRMLYSLDSDRFQVMFRYFEDRAIQKDKSGMMQCVVAVSDKVFEVFLQMMVDKPKT
KAHEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLAETFPHLLWSGRVLRTMLDILQTL
SLSLSADIHKDQPYYDIPDTPHRITVPDTYEARESIVKDFAARCGEILKEAMKWAPSVTK
SHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNRQSTTLGSTQLTERPACVKKDYS
NFMASLNLRNRYAGEVSGMIHFAQAVRGLSDLSQLMIKQMGEALDSGQPEAFTEAMFKLA
ALLISSKECDPQLLHHLCWSPLKMFTAHGMETAIACWEWLLAARVGVEVAFMREMAGAWQ
MTVELKKGLFSDTQVEADPLAASEESQPIPCPPDITPHHIWLEFLVQRFEIAKYSSADQV
EIFGTLLQRSLSLNVGGVNSSLNRHVAAIGPRFRLLTLGLALLHSDVLTNATVRNVLREK
IYSTAFDYFSGAPKFPTQGDKNLREDISIMIRFYASILSDKKYLAACHLVPPDNQDPSLN
SLSVMNAADLRSNMDSSSRSQQGGQGWINTYPLSSGVSTASKKSGTSKKSNRGTQLHKYY
MKRRTLLLALLASEIERLMTWYNPLSTQELAISMEQSVETSIANWRSKYISLTEKQWKDN
VNLAWDISPYLAIQLPTRFKNDAIVAEVTRLVRMDPGAVSDVPEAVKFLVTWHTIDADSP
ELSHILCWAPADPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYD
KMGYVREYILWAAQTSQLLAHQFIWNMKTNIFVDEEGHHKDPDIGDLLEQMVEEITSSLS
GPAKDFYQREFDFFNKITNVSAIIKPVPKGEERKRACLKALSDIKVQQGCYLPSNPEAVV
LDIDYKSRTPMQSAAKAPYLAKFKVKRCGVSELEREGLRCASDSTDEQNSDGSSRVCWQA
AIFKVGDDCRQDMLALQIIGLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCKSRD
QLGRQTDFGMYDYFRNQYGDESTLAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLD
SKGHLIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLA
VRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKGRFNPQMSEKEAAAFIIKVIQSCFLSSR
SKTYDMLQYYQNQIPY
Download sequence
Identical sequences H3D7N6
ENSTNIP00000016527 ENSTNIP00000016527 99883.ENSTNIP00000016527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]